KEGG   Rhodospirillum photometricum: RSPPHO_03010Help
Entry
RSPPHO_03010      CDS       T01851                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpm  Rhodospirillum photometricum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rpm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rpm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3620704..3621759
Genome map
AA seq 351 aa AA seqDB search
MTPSRPGDRGASLSAEPLALILGVSGLTPTPWEAAFLREINPFGFILFRRNVRDPDQVRA
LTESLRALVGRPDAPVLIDQEGGRVHRLKPPLWRAPPPAEVFGQLYARDPALGREAAWLN
ARLIAHDLLALGIDTDCLPVLDVRHPGAHDIVGDRAFSEDPDEVTTLGAAVIDGLEAGGV
YPVVKHIPGHGRAQADSHEALPVIDTAFDDLVAHDLVPFRALAQAPFAMTAHILYTALDA
DAPATLSPTVIERVIRGACAFDGLLMTDDLSMKALAGSMEERSRRSLAAGCDLVLHCNGD
ASEMEQAARGARPLDSAAQRRWDTARQQRRLPDPGYDAAGGLARLGELLNG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccctcgcggcccggggacaggggtgcctcattgtccgctgaacccttggccctc
attctcggggtgtcgggcctgaccccgaccccctgggaagccgcgtttttgcgcgaaatc
aatccgttcggttttatcctgttccggcgcaacgtccgcgatcccgatcaggtgcgcgcc
ctcaccgagtccctgcgggccttggtcggtcgccccgacgcgcccgtgctcatcgaccag
gaggggggccgcgtccatcgcctgaagccccccctgtggcgcgccccgccgcccgccgag
gtgttcgggcagctgtatgcccgcgacccggccctgggccgcgaggcggcatggctcaat
gcccgcttgattgcccacgacctgttggctctgggcatcgataccgattgcctgccggtt
cttgatgtccgccatcccggggcccacgacatcgtgggcgaccgcgccttctccgaggat
cccgacgaggtgaccaccttgggggcggcggtgatcgacgggttggaagcgggaggcgtc
tatcccgtggtcaagcacatccccggccacggtcgggcccaggccgacagccatgaagcc
ctgccagtcatcgataccgcgtttgatgatctggtggcccacgatctggtgccgttccgg
gccctggcccaggcgccgttcgccatgaccgctcatattttgtatacggcacttgatgcc
gatgccccggccaccttgtcgcccacggtcatcgagcgggtgattcgcggcgcctgtgcc
ttcgacggccttctgatgaccgatgacttgtcgatgaaggccctggctgggtccatggag
gagcgctcgcggcgctctctggcggcagggtgcgacttggtgttgcattgcaacggcgat
gcctccgaaatggagcaggcggcgcgcggcgcccgtccccttgactccgccgcccagcga
cgctgggacaccgcccgccaacagcgccgcctgcccgatcccggctacgatgccgccggc
ggtctggcgcgcctgggggagctgctcaatgggtga

DBGET integrated database retrieval system