KEGG   Rhodospirillum photometricum: RSPPHO_03010Help
Entry
RSPPHO_03010      CDS       T01851                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpm  Rhodospirillum photometricum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSPPHO_03010
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSPPHO_03010
Enzymes [BR:rpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSPPHO_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3620704..3621759
Genome map
AA seq 351 aa AA seqDB search
MTPSRPGDRGASLSAEPLALILGVSGLTPTPWEAAFLREINPFGFILFRRNVRDPDQVRA
LTESLRALVGRPDAPVLIDQEGGRVHRLKPPLWRAPPPAEVFGQLYARDPALGREAAWLN
ARLIAHDLLALGIDTDCLPVLDVRHPGAHDIVGDRAFSEDPDEVTTLGAAVIDGLEAGGV
YPVVKHIPGHGRAQADSHEALPVIDTAFDDLVAHDLVPFRALAQAPFAMTAHILYTALDA
DAPATLSPTVIERVIRGACAFDGLLMTDDLSMKALAGSMEERSRRSLAAGCDLVLHCNGD
ASEMEQAARGARPLDSAAQRRWDTARQQRRLPDPGYDAAGGLARLGELLNG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccctcgcggcccggggacaggggtgcctcattgtccgctgaacccttggccctc
attctcggggtgtcgggcctgaccccgaccccctgggaagccgcgtttttgcgcgaaatc
aatccgttcggttttatcctgttccggcgcaacgtccgcgatcccgatcaggtgcgcgcc
ctcaccgagtccctgcgggccttggtcggtcgccccgacgcgcccgtgctcatcgaccag
gaggggggccgcgtccatcgcctgaagccccccctgtggcgcgccccgccgcccgccgag
gtgttcgggcagctgtatgcccgcgacccggccctgggccgcgaggcggcatggctcaat
gcccgcttgattgcccacgacctgttggctctgggcatcgataccgattgcctgccggtt
cttgatgtccgccatcccggggcccacgacatcgtgggcgaccgcgccttctccgaggat
cccgacgaggtgaccaccttgggggcggcggtgatcgacgggttggaagcgggaggcgtc
tatcccgtggtcaagcacatccccggccacggtcgggcccaggccgacagccatgaagcc
ctgccagtcatcgataccgcgtttgatgatctggtggcccacgatctggtgccgttccgg
gccctggcccaggcgccgttcgccatgaccgctcatattttgtatacggcacttgatgcc
gatgccccggccaccttgtcgcccacggtcatcgagcgggtgattcgcggcgcctgtgcc
ttcgacggccttctgatgaccgatgacttgtcgatgaaggccctggctgggtccatggag
gagcgctcgcggcgctctctggcggcagggtgcgacttggtgttgcattgcaacggcgat
gcctccgaaatggagcaggcggcgcgcggcgcccgtccccttgactccgccgcccagcga
cgctgggacaccgcccgccaacagcgccgcctgcccgatcccggctacgatgccgccggc
ggtctggcgcgcctgggggagctgctcaatgggtga

DBGET integrated database retrieval system