KEGG   Rhodospirillum photometricum: RSPPHO_03134Help
Entry
RSPPHO_03134      CDS       T01851                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_03134
   00052 Galactose metabolism
    RSPPHO_03134
Enzymes [BR:rpm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RSPPHO_03134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3759457..3760467
Genome map
AA seq 336 aa AA seqDB search
MESREIGVLGGDPVQEIRLSTPAGAQALVLSYGATLRDLVVPLGDGRTRRVVLGYQSIEA
YRHNPCYLGATIGRCANRIADDHFVLDGQTSPLPANSAGGIHLHGGPQGFSRRPWRVVEA
DQSSVLLALTSEDGDQGYPGRVEVTCRYHLSDSTCLRLEMTGEADAPTLLNLTNHTYFTL
ADDASADDHFLEIAARFHTPARDTLIPTGEIRFVEGTPYDFRRLRRIGDAKVPYDINFVL
DGADGTVRPVARARSPQQDLELEVHTDQPGLLLYTGSALFQAGPGLEGQKHGPGAGFCLE
TYRFTDSIHQPHFPSVILRPGERYTHRCEYRFNALA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagagtcgcgagatcggcgtgctgggcggagatccagtccaggaaatccgcctttcc
actccggccggcgcccaggcgctggttctcagctacggcgccaccttgcgcgatctggtg
gtaccgctgggcgacggccggacgcggcgcgtggtgttgggctatcagagcatcgaggcc
taccgccacaacccgtgctacctcggcgcgaccattggccgttgcgccaaccgcatcgca
gacgatcacttcgtgctggacggacagacctcccccctgcccgccaacagcgcgggcggc
atccacctgcacggcggcccccagggcttttcccgccgcccctggcgggtggtggaggcc
gaccaaagctcggtgctgctggccctgacctccgaagacggcgaccagggctaccccggg
cgggtcgaggtcacgtgtcgctatcacctaagcgacagcacgtgcttgcgccttgaaatg
accggcgaagccgacgcgccaacccttctcaacctgaccaaccatacctatttcactctg
gccgacgacgccagcgccgatgaccattttctggaaatcgcggcccgcttccataccccg
gcccgggacaccctgatccccaccggcgagatccgctttgtcgagggcacaccgtatgac
tttcgtcgcctgcggcgtatcggcgacgccaaggtgccctacgacatcaattttgttttg
gacggcgccgacggcaccgttcgccccgtggcccgggcccgctctccccagcaggacctg
gaactggaggtccacaccgaccagcccggcctcctgctttataccggctcggccctgttt
caagcaggccccggccttgagggacaaaagcacggtccgggcgcgggcttttgtctggaa
acctatcgctttaccgattccatccaccagccgcacttcccctcggtgatcctgcggccg
ggtgaacggtatacccaccgctgcgagtaccgattcaacgccctggcgtga

DBGET integrated database retrieval system