KEGG   Rhodospirillum photometricum: RSPPHO_03222Help
Entry
RSPPHO_03222      CDS       T01851                                 

Definition
Hypothetical 1041 kDa protein in hypE 3'region
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rpm  Rhodospirillum photometricum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSPPHO_03222
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RSPPHO_03222
Enzymes [BR:rpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RSPPHO_03222
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RSPPHO_03222
Two-component system [BR:rpm02022]
 CheA family
  CheA-CheYBV
   RSPPHO_03222
Bacterial motility proteins [BR:rpm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RSPPHO_03222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3869318..3872026)
Genome map
AA seq 902 aa AA seqDB search
MVLPLSSVVKASPLHTLFPFPVVGIGASAGGLEALERFIAATSPTSGMAFIIVQHLDPKQ
KSLVPALLQRITLMPVGEASDGMVVEPNHIYVLKPHKTLSIAQRTLFTRDPVSARPPAGP
IDHFFCSLAEDVQNHAVGVILSGMGDDGTQGMSAIRAHGGITAVQDPAEATFPAMPKAAM
ASGGVDIIAPADALPRQIQARLDTAPIRLPVQPPFLPTDPNAKGALDEILALLHQRTGND
FSVYKTSTLIRRIDRRVALHRMGTLSAYARYVHDTPRETALLFKELLIGVTRFFRDPLVW
AAVATEALPALLANRSTHDEIRAWVPACSTGEEAYSLAIAFTEALDTRPSPLPPLSLRLY
ATDLDPDAIERARQGFYPESITADVSPERLARFFVAEEGGYRIIRHIRDSITFAEQNIIS
DPSFTHLDFISCRNVFIYLDASFQKKIIPIFHYCLNPNGLLLLGSAESIGEFSDLFSPFD
RKLQIYRRENQPVRRAALTGLPHPSSPRRPPPFHSPDLLLETSPDEEETRTPRALMERLL
LNDFCPAAVLVNANGDILYVSGRTGKYLEPAMGKANLNVHAMARDGLRRPLAAGFGRLAQ
GPVILSDLTMATESGSQKVTITLRPLTQSDSGPETILIVFSDDPTVIKTSWFQRHKAPTL
PLERPPDGERILCEIQDAMKEMKSKRDEQQKKNEDLQAKNEELSTSIEEMLSLNEELHSV
NAEMQSKIDDLLFVNNDMNNLLGSTEIATVFLDSLLNLRRYTPHATTLFRLLPGDVGRPL
SDIANDLIHPTLEQDAWEVLRTLVVAERQVPTRKGRWIMVRTMPYRTQENVIDGVVITFL
DMTEVKTLELELLRRQDSILEHEREPDHDRSAEPRPPQGGSPPLSPSVTPAGDADHRAAA
PD
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
ttggttttgcccctttcctctgttgtgaaagcctctcctttgcacaccctttttcccttt
cctgttgtggggatcggggcctcggcgggtggtctggaggccctggagcgttttattgcc
gccacttcgcccacaagcgggatggccttcatcattgttcaacaccttgatcccaaacaa
aaaagcctcgtccctgccttgctgcaacgcatcacattgatgcccgtcggcgaggcgagt
gatggaatggtggttgaacccaaccacatttacgttctgaagccgcacaagaccctgtcg
atcgcccagagaaccttgttcacccgcgatccggtctcggcccgtcctccggcagggccc
atcgaccactttttttgcagcctagccgaagacgtgcagaaccatgccgttggggtgatc
ttgtcgggaatgggggacgacggcacgcaaggaatgagcgccatccgggcgcacgggggc
atcacggccgtgcaagaccccgccgaggccacgttccccgccatgcccaaggccgcgatg
gcctctggtggcgtggacatcatcgcccccgccgacgccctaccccgccagatccaggcc
cgcctcgacaccgcccccatccggctccccgtccagcctcccttcctccccaccgatccc
aatgccaaaggcgccctggacgagatcttggccttgttgcaccaaagaaccggcaacgat
ttttctgtttacaagacatcgaccctgattcgccgcatcgatcgacgcgtggccttgcac
cgaatgggcactctgtcagcctatgcccgctacgtgcacgacacccccagggagacggcc
cttctgttcaaggaactgttgattggggtcacgcgttttttccgcgatccccttgtgtgg
gcggcggtggcaaccgaagctcttcccgccttgctggcaaaccgatcgacgcacgacgag
atcagggcctgggtccctgcctgctcgacgggcgaggaggcgtattcgctggccatcgcc
ttcaccgaagccctggacacccgcccgtcgcccctcccccccctctccttgcgcctttac
gcgacagacctggacccggacgccattgaacgggcgcggcaaggcttttatcccgagagc
atcaccgccgatgtctccccagagcgcttggcccgtttttttgtcgccgaggaaggggga
tatcgaatcattcggcacattcgcgactcgatcacatttgccgagcaaaacattatctcg
gacccttcctttacacacctggatttcataagttgccgcaatgtttttatctatcttgac
gcttcttttcagaaaaaaattattcccatattccactattgcctgaatcctaatggactt
ttattgctgggaagcgccgagtcaattggtgagttctcggatcttttttctcctttcgac
cggaaattgcagatttatcggcgagagaaccaaccggttcggcgagcggcgctcaccggc
cttccccacccctcctctccccgtcgccccccccctttccactctcccgacctgctcctt
gagacctcccccgacgaggaagagacccggacaccccgggccttgatggagcggctgttg
ctcaacgacttctgcccggcggccgtgctggtcaatgccaacggggatatcttgtacgtg
agcgggcgcacgggaaaatacctggagccggccatgggcaaggccaatctcaacgtgcat
gccatggcgcgggacggcctgcgccggcccctggccgccggctttgggcgccttgcccag
gggccggttatcttgtcggacctgaccatggcaaccgaaagcggctcgcaaaaggtgacg
atcaccttgcgccccctcacccagtcggacagcggcccggaaacaatcctgatcgtgttt
agcgacgaccccacggtgatcaaaacatcctggttccagcggcacaaggcgccgacgctc
cctttggagcgaccgccggacggggaacggatcctctgcgagatccaagacgccatgaaa
gaaatgaagtcgaagcgcgacgaacaacagaaaaagaatgaagaccttcaggcgaagaac
gaggaactcagcacatcaatagaagaaatgctgtcgctgaacgaggaactccacagcgtc
aatgccgagatgcaatccaagattgacgatttattgtttgtaaacaacgacatgaataac
cttttgggaagcacggaaattgccaccgtcttccttgattctctgttgaatttgcgccgt
tacactccgcatgcgacgactttgtttcgccttctgcccggcgacgttggccgccctctg
tccgacatcgccaacgacctgatccaccccaccttggaacaagacgcctgggaggttttg
cgcaccttggtggtcgcggaacgccaagttccaacacgcaaagggcgctggatcatggtt
cgcaccatgccctaccgcacgcaagagaatgtgattgatggggtggtgatcacctttctc
gacatgacagaagtcaagaccctggaactcgaacttcttcgacgacaggactccattctt
gaacacgagagagagccagatcatgaccgatccgccgaaccccgaccgccgcaggggggc
tcgccccccctctccccctctgtcaccccagcgggtgacgccgatcaccgagccgctgcg
cctgattga

DBGET integrated database retrieval system