KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_00175Help
Entry
MA1_00175         CDS       T01788                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rpo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rpo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42829..44016)
Genome map
AA seq 395 aa AA seqDB search
MLSKLNKPALFALIFYPVFIISLVVKYSFDYGIGLTEIIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLVMLSAGTLQGPALSWASNHYKHHAKTDTDQDPHSPLKFDNKVLGF
LWSHIGWMLIGSGSYKFIDRITWAKLGKNNLLKWQLKYYWKIAAFMNIVVPLFTGYLVGG
TIKSAYAGFLFIGLGRFLQQQATFCVNSLCHFVGSKKYYRGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGVKWYHFDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLSLMQTKIDNLLENLCLKSKEIEESSLAIKEQLKKSFVEIQESLKNLAEQVSSATQI
TEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataaacctgctttatttgctttaatattttatcctgtttttatt
atatctcttgtagttaaatattcgtttgattatgggataggattaactgaaattattttc
ataattgctagttattatattaataatattaccgttgggattggtttacacagattatgg
tctcataatgcatataaaataaataaatatgctgagtttgttttagttatgttatctgca
ggaacattgcaaggaccggctttatcttgggcatctaatcattataaacatcatgctaaa
acagatacggatcaagatccacatagtcctctaaagtttgataataaggttttaggattt
ctttggtcacatatagggtggatgctaataggcagcgggagttataagtttattgatcgc
attacttgggctaagcttggtaaaaataatttactaaaatggcaattaaaatattattgg
aagatagcggcttttatgaatattgtagtacctttatttacaggttatttagttggtggc
actataaaatcagcatacgcaggattcttatttattggacttgggagattcttacaacaa
caagcaacattttgtgttaattctctatgccactttgtcgggagtaaaaaatactacaga
ggtactgctggagacatttggtggatggcattattcttacttggtgaaaattggcataat
tatcatcatgcttttccttcagattatcgtaatggtgtcaagtggtatcattttgatgtt
cataaatggataatatttttaatgagtaaaataggtttagcttcggagcttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgagaaacaa
aagcaaaaattgagtttaatgcaaactaaaatagataatttattagaaaatctatgctta
aaaagcaaagaaattgaagaatcctctcttgctattaaagaacaactaaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcagagcaagtaagttctgcaacgcaaata
acagaaaaaccttcagaaaaattactaaaaatagtgaataaaaaaataattgatgctgaa
caatctatttataaactgtataatcagttgaataccttaaaggtatag

DBGET integrated database retrieval system