KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_01440Help
Entry
MA1_01440         CDS       T01788                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MA1_01440
Enzymes [BR:rpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MA1_01440
Transfer RNA biogenesis [BR:rpo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MA1_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364570..365358
Genome map
AA seq 262 aa AA seqDB search
MNDNLINALKDLIINTGKVALDIKKTGILIDTKSDGSVVTNADQEISKIIYQTLRSLTSQ
IAIVCEEQPLPILNSDTFWLIDPIDGTRSYVEGKNTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSQEIFVNYSPKHKEPNAVVGFYNSNKATKEFLRSYSFGKINAIS
SSIKLCLIAEGKADIYPKFGQTMEWDIAAGHALIKASGGNILDCDGQEVTYGKANFANPH
FFACSKYWLEMDSVFVSTKSLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaatactggtaaggttgcg
ctagatatcaaaaaaacaggaatattgattgatactaaatcagatggttctgtagtcact
aatgcagatcaggaaattagtaaaataatttatcaaactttacgaagcttaacatctcaa
atagcaatagtatgtgaagagcagccactacctatattaaatagtgatactttttggtta
atagatcctattgatgggacacggagctatgtagagggtaaaaatacctatacagtaaat
ataggccttattgaaaatggttttccgactatcggtttgatatatcatcctgaaactgcg
aagctgtattatactgatgtaaacggtcgattaaaaatcgaacaaaattctcaagaaata
tttgtgaattattcacctaaacataaagagcctaatgctgttgtaggtttttataattca
aataaagctactaaagaatttttaaggagttattcattcggtaaaataaatgcaataagc
agttcaattaaattatgcttaattgccgaaggtaaagctgatatatatcccaagtttggc
caaactatggagtgggatatagcagcaggtcatgcactaattaaagctagcggcggtaat
attttagattgcgatggtcaagaagttacttacggtaaagcaaattttgctaatcctcat
ttttttgcatgcagtaaatattggttggaaatggattctgtttttgtgtctactaaatcg
ttattgtaa

DBGET integrated database retrieval system