KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_02130Help
Entry
MA1_02130         CDS       T01788                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MA1_02130 (recR)
DNA repair and recombination proteins [BR:rpo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MA1_02130 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534152..534751
Genome map
AA seq 199 aa AA seqDB search
MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEIC
GNLDTKSICHICSSEYRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPR
ILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEHPAKISRLASGIPIGGEL
DYLDEGTLSAAISLRQPCE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaatgatatagatcaattaatctatcttttttcaaaattacctggtctt
ggcattagatcagcaaggcgtatagtactttatctattgcaagataaagatgtaaggcta
aaaagcctaattaatcatcttatagagctcgataagaaaatagtaaaatgcgagatttgt
ggtaatttggatacaaaaagtatttgccatatttgttcttctgaatatagagataaatcg
actatcgctattgttgaaaccgtagctgaattatgtgcaatggagcgtagtggtaatttt
aaaggtttatatcatgtactcggtcataatttatctgcagctagtagacagaaccctcgc
atacttcgtttacctgaattacttaaaagatgttttgtagaaaatattaaagaagttatt
attgcgactaattctactttagaaggtcagactactgcttattttattatagaatattta
aaagaacatcctgctaaaatttctcgccttgcaagcggtatacctattggaggtgaactt
gactatttagatgaaggcaccttatctgctgctattagcctacgtcaaccttgtgaataa

DBGET integrated database retrieval system