KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_02585Help
Entry
MA1_02585         CDS       T01788                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
rpo00860  Porphyrin and chlorophyll metabolism
rpo01100  Metabolic pathways
rpo01110  Biosynthesis of secondary metabolites
rpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MA1_02585
Enzymes [BR:rpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MA1_02585
Exosome [BR:rpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MA1_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD UxuA DUF2097
Motif
Other DBs
NCBI-ProteinID: AFE51033
Position
complement(667417..668409)
Genome map
AA seq 330 aa AA seqDB search
MYPLIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNEMQEIKTMPGIYRLSIDQI
VETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTIIKIKNANIDIGIICDV
ALDPYTISGHDGIVHHGEVDNDRSVKALCNQALVLAKAGVDIVAPSDMMDGRIAAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSYQIDVRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAETGAIDWERALIES
LISFKRAGATGIFTYAALEVAEILKHNNIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcttattagatttagaagaaatagaaaagctttatggcttagagagttaata
gcagagagtaatttatcgattagtgatttagtgttacctttatttgttgttgaaggccat
aatgaaatgcaagaaattaagactatgcctggtatatatcgtttatcgatcgatcagata
gttgaaactgcaaaaaaagcagcagattttggtattaatgcgattgcattatttcctagt
attgatcacagtctaaaaagtgacaatgcagatgaggcatataatttagataatttaata
tgtagaactattataaaaatcaaaaacgccaatattgacattggtataatatgtgatgta
gcacttgatccttacactataagtggccatgatggtattgttcatcatggagaagttgat
aatgataggtcagtaaaagctttatgtaatcaagcattagtattagcaaaagctggagta
gatatcgttgcaccttctgatatgatggatggaagaatagcagctatcagggagtatctt
gacaaagaaggctttataaatgtaggaattcttgcttatgcagctaaatatgcttcaagc
ttttatggcccatttcgcgatgcagttcagagtaataaaaagaattatttagataaatca
agctatcaaattgatgtgcgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagaaggagcagatattgtaatggttaaaccaggtatgccgtttttggatgtgattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggttagtggggaatacgca
atgttaaaatttgcagcagaaacaggggctattgattgggagagagcgttaatagaatca
ttaattagttttaaacgtgccggtgcaacaggaatatttacctatgctgctcttgaagta
gctgaaatattaaagcacaataacattaagtag

DBGET integrated database retrieval system