KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_02675Help
Entry
MA1_02675         CDS       T01788                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
rpo00071  Fatty acid degradation
rpo00280  Valine, leucine and isoleucine degradation
rpo00281  Geraniol degradation
rpo00310  Lysine degradation
rpo00362  Benzoate degradation
rpo00380  Tryptophan metabolism
rpo00640  Propanoate metabolism
rpo00650  Butanoate metabolism
rpo00903  Limonene and pinene degradation
rpo00930  Caprolactam degradation
rpo01040  Biosynthesis of unsaturated fatty acids
rpo01100  Metabolic pathways
rpo01110  Biosynthesis of secondary metabolites
rpo01120  Microbial metabolism in diverse environments
rpo01130  Biosynthesis of antibiotics
rpo01200  Carbon metabolism
rpo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MA1_02675
   00650 Butanoate metabolism
    MA1_02675
  Lipid metabolism
   00071 Fatty acid degradation
    MA1_02675
   01040 Biosynthesis of unsaturated fatty acids
    MA1_02675
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MA1_02675
   00310 Lysine degradation
    MA1_02675
   00380 Tryptophan metabolism
    MA1_02675
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MA1_02675
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MA1_02675
   00281 Geraniol degradation
    MA1_02675
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MA1_02675
   00930 Caprolactam degradation
    MA1_02675
Enzymes [BR:rpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MA1_02675
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MA1_02675
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MA1_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_Gly3P_dh_N NAD_binding_2 UDPG_MGDP_dh_N ApbA NAD_binding_8 Pyr_redox_2 DAO F420_oxidored Epsilon_antitox
Motif
Other DBs
NCBI-ProteinID: AFE51051
Position
complement(698697..700859)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHQVVLLDILDKDSNDPNKIVKNSVKNLHKQKL
SPLSFPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKKLKVNLPNNIKSRFVITHFFNPPRYMELVELIIDHTIKDEVIEKVSVFLTKM
LGKTIIKCNDTPGFIANRVGCFLLELVVHKAIAQNLNFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLISALPKSDDYHRIYTNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNSLNELLSSNSIYGKFFSEIITEFYIYLTSLVPSVT
NNIYDIDTTMKLGYSWHYGPFELLTIAVKNGWNLIIKNADLMNIPLPKYLASKEYQKIDK
QKFNSKKDFLQESKIVLSNDSANLIHYCENLVFVITTKMNSLNHNVFYLLQEAVSKAENY
GKNLYIYPQGNNFSAGADLKLILSYIQDGNFHNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPGWTGVTEMFARSNGNKTKLIRNIK
NIIEQNKTSSADYFKADYGIKNMQVNMNKHYILDDALKLRISKKIVSIPNKITLPKINIV
SEIDTSKYNELQNKVLNKFQNIIDKHNEISEAELLTYEREMFLELAKTPQTIEKLQAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagtcatgggttcaggcatt
gcagcgttgattgctaattcctctcatcaagtagttctgcttgatattcttgataaagat
tctaatgatcctaataaaatagtaaaaaattctgtaaagaatttgcataaacaaaagctt
tctcctttatcttttccagataaagtcaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttatcgttgagaagttagaaatc
aaacatcaattatataataaaattataccttatcttaaagaagacgcaattatcgcttct
aacacctctacattgccgctaaaaaaactcaaagtgaatttaccaaataatataaagtca
agattcgttattacacatttctttaatccaccgcgatatatggaattggttgaattaatt
atagaccatacaatcaaggatgaggtcatagaaaaagtatcagtgttcttaactaaaatg
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtagga
tgttttttacttgagttagtagtccacaaagcgatagctcaaaatcttaattttgttaca
atagatcaaatattcagtagatgtttaggtttgccgaataccggaatttttggtttatat
gatttaataggtcatgacgtaatgaagttgatatcaagttcattaatttctgctttacct
aaaagtgatgattatcataggatatatactaataccaaagtgtttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aagaagattaaagaagtgattaatataagtgatttatcatatcaccctgttcaaaaagta
gatatttcgtttaatagtctcaatgagttgctatctagcaattcaatttatggtaagttt
tttagtgagattattacagaattttatatttatttaacaagcttagtaccatccgtgact
aataatatctacgatatcgataccactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaatttgataattaaaaatgctgat
ttaatgaatattccactgcctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtaaaatagtattatcgaatgat
tctgcaaatttaatacattattgtgagaatttagtatttgttattactacgaaaatgaat
agtttaaatcataacgtattttacttattgcaagaagccgtaagtaaagcagaaaattat
ggaaaaaatctttatatttatccacaaggaaataatttttctgcaggtgcggatttaaag
cttattctttcttatattcaagatgggaattttcataatttagagaatttactaaagctt
ggacaacaaacaatgcgttatttaaaatattcttcggtacatattattagctgtgctcgt
ggtgttgcacttggaggcgggtgtgaacttctattgaactcaagctatattgtagcaaat
caggagcttaatgctggacttatagagcttggagtaggtttaataccaggatggaccggt
gttacagaaatgtttgcccgaagtaatggaaataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatggtata
aagaatatgcaagtcaatatgaacaagcattatattttagatgacgctttgaaactcaga
atatctaaaaaaatagtctccataccgaataaaattactttacctaaaattaatatagtt
agtgaaatagatacatcaaaatataacgagctacaaaataaggtacttaataaatttcag
aatattattgataaacataatgaaataagtgaagcagaattactgacatatgagcgtgaa
atgtttttagaacttgcaaaaacaccacaaactatagagaaattgcaagcgattgtgggg
taa

DBGET integrated database retrieval system