KEGG   Rickettsia parkeri: MC1_00255Help
Entry
MC1_00255         CDS       T01785                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rpp  Rickettsia parkeri
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38534..38938)
Genome map
AA seq 134 aa AA seqDB search
MKQLGRASSYDKWSPRVIDLDILLWNNCHIDLPDLKIPHPEVLNKPFLIHLIAGLSLECR
YSCPINNFYNNKTFAEIAHLIEHQGVIRSLVLNPQFVGILNITPDSFSDGGLSFHKEDAV
RNFVRLINEGATIN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaactaggtcgagcaagctcttacgataaatggtctccaagagttattgactta
gatatcctactttggaataattgccatatagatttacctgatttaaagataccgcatcct
gaagtattaaacaaaccgtttcttattcatctaattgcaggtttaagcttggaatgtcgt
tattcatgtccgatcaataatttttacaacaataaaacctttgcagaaatagcacattta
attgaacatcaaggagttatacgctctcttgttttaaatcctcaatttgtcggtatttta
aacattactcctgattctttttctgatggaggattgagttttcataaagaagatgccgtt
agaaattttgtacgcttgataaatgaaggggctacaataaattga

DBGET integrated database retrieval system