KEGG   Rickettsia parkeri: MC1_00255Help
Entry
MC1_00255         CDS       T01785                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rpp  Rickettsia parkeri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC1_00255
Enzymes [BR:rpp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MC1_00255
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MC1_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38534..38938)
Genome map
AA seq 134 aa AA seqDB search
MKQLGRASSYDKWSPRVIDLDILLWNNCHIDLPDLKIPHPEVLNKPFLIHLIAGLSLECR
YSCPINNFYNNKTFAEIAHLIEHQGVIRSLVLNPQFVGILNITPDSFSDGGLSFHKEDAV
RNFVRLINEGATIN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaactaggtcgagcaagctcttacgataaatggtctccaagagttattgactta
gatatcctactttggaataattgccatatagatttacctgatttaaagataccgcatcct
gaagtattaaacaaaccgtttcttattcatctaattgcaggtttaagcttggaatgtcgt
tattcatgtccgatcaataatttttacaacaataaaacctttgcagaaatagcacattta
attgaacatcaaggagttatacgctctcttgttttaaatcctcaatttgtcggtatttta
aacattactcctgattctttttctgatggaggattgagttttcataaagaagatgccgtt
agaaattttgtacgcttgataaatgaaggggctacaataaattga

DBGET integrated database retrieval system