KEGG   Rickettsia parkeri: MC1_00260Help
Entry
MC1_00260         CDS       T01785                                 

Definition
folate synthesis bifunctional protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpp  Rickettsia parkeri
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38935..39153)
Genome map
AA seq 72 aa AA seqDB search
MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQAILQPNADKAWDKSYLNMVVQGKSTL
TPSKLLIELNKD
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggtaataaacttttaaatattaaaaaagct
ctaaattcactaaaaagttgtaattttatatcgcttaagcaagccattctacaacctaat
gcagataaagcttgggataaatcatatttaaatatggtggtgcagggcaaaagtacttta
acgcctagtaaacttctaattgagcttaacaaagattga

DBGET integrated database retrieval system