KEGG   Rickettsia parkeri: MC1_00260Help
Entry
MC1_00260         CDS       T01785                                 

Definition
folate synthesis bifunctional protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpp  Rickettsia parkeri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC1_00260
Enzymes [BR:rpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MC1_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38935..39153)
Genome map
AA seq 72 aa AA seqDB search
MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQAILQPNADKAWDKSYLNMVVQGKSTL
TPSKLLIELNKD
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggtaataaacttttaaatattaaaaaagct
ctaaattcactaaaaagttgtaattttatatcgcttaagcaagccattctacaacctaat
gcagataaagcttgggataaatcatatttaaatatggtggtgcagggcaaaagtacttta
acgcctagtaaacttctaattgagcttaacaaagattga

DBGET integrated database retrieval system