KEGG   Rickettsia parkeri: MC1_01890Help
Entry
MC1_01890         CDS       T01785                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rpp  Rickettsia parkeri
Pathway
rpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MC1_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 SDF Senescence_reg
Motif
Other DBs
NCBI-ProteinID: AFC74532
Position
complement(342266..342793)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANTDNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctatagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacaccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattcccttgataaagacggtccaaataaactaggaccg
catctttgggatgtcgcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system