KEGG   Rickettsia parkeri: MC1_02255Help
Entry
MC1_02255         CDS       T01785                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpp  Rickettsia parkeri
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MC1_02255
Enzymes [BR:rpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MC1_02255
Transfer RNA biogenesis [BR:rpp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MC1_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403321..404097
Genome map
AA seq 258 aa AA seqDB search
MNDNLINALKDLIINTGKIALDIKKAGMLTDIKSDGSVVTNADKEISKIIYQTLQTLTSQ
IAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSKEIFVNHEPKHEELKAVIGFYNSNKATKEFLSKYSFGQINAIG
SSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQEITYGKESFANPN
FFACSKYWLEREAKLHRY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaataccggcaagattgca
ctagatataaaaaaggcaggaatgttgactgatattaaatcagatgggtcagtagtcact
aatgccgataaagaaattagtaaaataatttatcaaactctacaaaccttaacctctcaa
atagctatagtatgtgaagagcagccgctacctatattcagcagtgatactttttggtta
atcgatcctattgatgggacatggagctatgtaaacggtaaaagtacatatacggtcaat
atagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaaacagca
aagctatattatactgatgtaaacggtcggttaaaaatcgaacagaattctaaagaaata
tttgttaatcatgaaccgaaacatgaagagcttaaggcggtaataggtttttataattca
aataaagctactaaagagtttttaagtaagtattcattcggtcaaataaatgcaataggc
agttcaatgaaactatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttaattaaagccggcggtggtaat
attttagatacgcatggacaagaaattacttacggtaaagaaagttttgctaatcctaat
tttttcgcctgtagtaaatattggttggaaagggaggcaaagttgcatagatactag

DBGET integrated database retrieval system