KEGG   Rickettsia parkeri: MC1_03005Help
Entry
MC1_03005         CDS       T01785                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpp  Rickettsia parkeri
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525912..526523
Genome map
AA seq 203 aa AA seqDB search
MIGQLSGKVDAQGDDYVIIDVNGVGYLVYASGKTLGKLAEGEFYKLFIETHVREEHIHLY
GFLTLEEKIFFNLLQSVNGIGTRMALFILSSLTPSDIQIAVNNEDKNIFKAISGVGAKLA
ERIVLELKGKVAKISSGSAIIKESLNIKNITPVASNEVIKALVNLGFSRFEAQNAVQGII
TQNPEISIDELIKTALKNRNSNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcaattaagtggtaaagttgatgcccaaggcgatgattacgttataattgac
gtaaacggggtagggtacttagtctatgcttcaggtaaaactttaggtaaacttgctgaa
ggggagttttataaactatttatcgaaacccatgttagagaggaacatattcatctttac
ggttttttgactctagaagagaagattttttttaatttactacaatcagtaaacggtata
ggtacaagaatggctttatttatcttatcaagccttacgccttcagatattcaaattgct
gtaaataatgaagataaaaatatatttaaagcaatatccggagtaggggctaaacttgct
gaacgtatagtgctagagctgaaaggtaaagtagcgaaaatatcaagcggttcagctatt
attaaagagagcttaaatattaagaatatcacacccgttgcaagtaatgaagtaatcaaa
gctctagtaaatctaggattttctagatttgaagctcaaaacgctgttcaaggcatcatt
acccaaaatcccgaaatctctattgatgaattaatcaaaacagccctgaaaaatcgaaat
tctaatttttag

DBGET integrated database retrieval system