KEGG   Rickettsia parkeri: MC1_03885Help
Entry
MC1_03885         CDS       T01785                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00620  Pyruvate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_03885
   00020 Citrate cycle (TCA cycle)
    MC1_03885
   00620 Pyruvate metabolism
    MC1_03885
Enzymes [BR:rpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MC1_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFC74878
Position
677252..678490
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDINAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ
VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKFFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacagacattaatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttccgaaaccccacgagaatatagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgagaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaagatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatttttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacaccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccacaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgttttgatgttgatataa

DBGET integrated database retrieval system