KEGG   Rickettsia parkeri: MC1_07550Help
Entry
MC1_07550         CDS       T01785                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpp  Rickettsia parkeri
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpp00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rpp00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295486..1295686
Genome map
AA seq 66 aa AA seqDB search
MKELGAKAVFYQGINLEKPDEIHSMFERIIKEFGKIDILVNNAGIQHVAPIDEFPEDKWE
QILRID
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaacttggggcaaaggctgtattttatcaaggaataaatttggaaaaacctgat
gaaattcattctatgtttgagaggataataaaagaattcggtaaaatagacatattagta
aataatgcaggtattcagcatgttgctcctatcgatgaatttcctgaagataaatgggag
caaattttgcgtatagattaa

DBGET integrated database retrieval system