KEGG   Rickettsia parkeri: MC1_07555Help
Entry
MC1_07555         CDS       T01785                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpp  Rickettsia parkeri
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MC1_07555
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MC1_07555
Enzymes [BR:rpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MC1_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295855..1296118
Genome map
AA seq 87 aa AA seqDB search
MAENNITVNAICPGYVNTPLVRNQIADTAKARHISEESALNVILKSQATKKFVEADEIAN
LVIFLCDKKASSITGSGLLIDGGWMAQ
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaataatattacagttaatgctatctgtcccggttacgtcaacacaccatta
gtaaggaatcaaatagcagatactgctaaagctagacatatcagtgaagaatcagcgtta
aatgtaatacttaaatctcaagctacgaaaaaatttgtagaagctgatgaaatagcaaac
ttagtaatattcttatgtgacaaaaaagcatcatcaataacaggtagtggactcttgata
gatggcggctggatggcacagtag

DBGET integrated database retrieval system