KEGG   Rickettsia prowazekii Rp22: rpr22_CDS036Help
Entry
rpr22_CDS036      CDS       T01977                                 

Gene name
aco1
Definition
Acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    rpr22_CDS036 (aco1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    rpr22_CDS036 (aco1)
Enzymes [BR:rpq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     rpr22_CDS036 (aco1)
Lipid biosynthesis proteins [BR:rpq01004]
 Desaturase
  First
   rpr22_CDS036 (aco1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42836..44023)
Genome map
AA seq 395 aa AA seqDB search
MLSKLNKPALFALIFYPVFIISLVVKYSFDYGIGLTEIIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLVMLSAGTLQGPALSWASNHYKHHAKTDTDQDPHSPLKFDNKVLGF
LWSHIGWMLIGSGSYKFIDRITWAKLGKNNLLKWQLKYYWKIAAFMNIVVPLFTGYLVGG
TIKSAYAGFLFIGLGRFLQQQATFCVNSLCHFVGSKKYYRGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGVKWYHFDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLSLMQTKIDNLLENLCLKSKEIEESSLAIKEQLKKSFVEIQESLKNLAEQVSSATQI
TEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataaacctgctttatttgctttaatattttatcctgtttttatt
atatctcttgtagttaaatattcgtttgattatgggataggattaactgaaattattttc
ataattgctagttattatattaataatattaccgttgggattggtttacacagattatgg
tctcataatgcatataaaataaataaatatgctgagtttgttttagttatgttatctgca
ggaacattgcaaggaccggctttatcttgggcatctaatcattataaacatcatgctaaa
acagatacggatcaagatccacatagtcctctaaagtttgataataaggttttaggattt
ctttggtcacatatagggtggatgctaataggcagcgggagttataagtttattgatcgc
attacttgggctaagcttggtaaaaataatttactaaaatggcaattaaaatattattgg
aagatagcggcttttatgaatattgtagtacctttatttacaggttatttagttggtggc
actataaaatcagcatacgcaggattcttatttattggacttgggagattcttacaacaa
caagcaacattttgtgttaattctctatgccactttgtcgggagtaaaaaatactacaga
ggtactgctggagacatttggtggatggcattattcttacttggtgaaaattggcataat
tatcatcatgcttttccttcagattatcgtaatggtgtcaagtggtatcattttgatgtt
cataaatggataatatttttaatgagtaaaataggtttagcttcggagcttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgagaaacaa
aagcaaaaattgagtttaatgcaaactaaaatagataatttattagaaaatctatgctta
aaaagcaaagaaattgaagaatcctctcttgctattaaagaacaactaaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcagagcaagtaagttctgcaacgcaaata
acagaaaaaccttcagaaaaattactaaaaatagtgaataaaaaaataattgatgctgaa
caatctatttataaactgtataatcagttgaataccttaaaggtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system