KEGG   Rickettsia prowazekii Rp22: rpr22_CDS121Help
Entry
rpr22_CDS121      CDS       T01977                                 

Gene name
sdhD
Definition
Succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rpr22_CDS121 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rpr22_CDS121 (sdhD)
   00650 Butanoate metabolism
    rpr22_CDS121 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    rpr22_CDS121 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149913..150290
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system