KEGG   Rickettsia prowazekii Rp22: rpr22_CDS171Help
Entry
rpr22_CDS171      CDS       T01977                                 

Gene name
sucB
Definition
Dihydrolipoamide acetyltransferase component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rpr22_CDS171 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rpr22_CDS171 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    rpr22_CDS171 (sucB)
Enzymes [BR:rpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     rpr22_CDS171 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212751..213956)
Genome map
AA seq 401 aa AA seqDB search
MSVKIIIPSLGESVTEATIAKWYKKLGDSVKTDELLLEIETEKVTLEVNAPCNGTIEKIA
KTDGANVTVGEEIGEINEVVDTDTACTNNNSYKKQAIVQHDSEQIVDKPASSSNILAPSV
QKLVTENKLDPNNIKGTGRGGRITKCDVLETINTTPVTIETPALNKTNEERTQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIE
ALKLIPSINAEIDGDDLLYKNYYDIGVAVGTDQGLVVPVVRDADKMGFADVEQAIGDLAK
KAREGKLSMSDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaaattataataccatcgcttggggaatcagtaacagaagcaactattgct
aaatggtataagaaattaggtgattcagttaaaactgatgaattactattagaaatcgaa
actgaaaaagtgactttagaagttaatgctccttgcaacggtactatagagaaaatagca
aaaactgatggtgcaaatgtaacagttggcgaagaaataggtgaaatcaatgaagttgta
gatacagatactgcttgtactaataataattcttataaaaagcaagcaattgtacaacac
gattcagaacagattgtagataaacctgcttcttctagtaatattcttgctccttcagta
caaaaattagtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggt
ggtagaattactaaatgtgatgtgctagaaaccataaacactacacctgttactattgag
actcctgcactaaataaaactaatgaagaaagaacacaacgcgtacgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatactgcagctattttgactact
tttaacgaaatcgatatgtcaaaagtcattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcatactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaa
gctttgaagcttattccatcaataaatgcggaaatagatggagatgatttattatataag
aactattacgatataggtgttgcagtaggaacagatcaaggacttgttgtaccagttgtt
agggatgccgataaaatgggttttgctgatgtagagcaagctatcggagatttggcaaaa
aaagctcgtgaggggaaactttctatgtctgatttgtcaggtggtacattctcaatttct
aatggaggagtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccaatgatgtatatagccttatcttacgatcatcgtataattgatggaaaagaggga
gtatcattcttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaac
ttgtag

DBGET integrated database retrieval system