KEGG   Rickettsia prowazekii Rp22: rpr22_CDS247Help
Entry
rpr22_CDS247      CDS       T01977                                 

Gene name
cycM
Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
rpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    rpr22_CDS247 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF5326
Motif
Other DBs
NCBI-ProteinID: ADE29764
UniProt: D5AWH5
Position
complement(309883..310410)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system