KEGG   Rickettsia prowazekii Rp22: rpr22_CDS291Help
Entry
rpr22_CDS291      CDS       T01977                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphatenucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpq00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364532..365320
Genome map
AA seq 262 aa AA seqDB search
MNDNLINALKDLIINTGKVALDIKKTGILIDTKSDGSVVTNADQEISKIIYQTLRSLTSQ
IAIVCEEQPLPILNSDTFWLIDPIDGTRSYVEGKNTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSQEIFVNYSPKHKEPNAVVGFYNSNKATKEFLRSYSFGKINAIS
SSIKLCLIAEGKADIYPKFGQTMEWDIAAGHALIKASGGNILDCDGQEVTYGKANFANPH
FFACSKYWLEMDSVFVSTKSLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaatactggtaaggttgcg
ctagatatcaaaaaaacaggaatattgattgatactaaatcagatggttctgtagtcact
aatgcagatcaggaaattagtaaaataatttatcaaactttacgaagcttaacatctcaa
atagcaatagtatgtgaagagcagccactacctatattaaatagtgatactttttggtta
atagatcctattgatgggacacggagctatgtagagggtaaaaatacctatacagtaaat
ataggccttattgaaaatggttttccgactatcggtttgatatatcatcctgaaactgcg
aagctgtattatactgatgtaaacggtcgattaaaaatcgaacaaaattctcaagaaata
tttgtgaattattcacctaaacataaagagcctaatgctgttgtaggtttttataattca
aataaagctactaaagaatttttaaggagttattcattcggtaaaataaatgcaataagc
agttcaattaaattatgcttaattgccgaaggtaaagctgatatatatcccaagtttggc
caaactatggagtgggatatagcagcaggtcatgcactaattaaagctagcggcggtaat
attttagattgcgatggtcaagaagttacttacggtaaagcaaattttgctaatcctcat
ttttttgcatgcagtaaatattggttggaaatggattctgtttttgtgtctactaaatcg
ttattgtaa

DBGET integrated database retrieval system