KEGG   Rickettsia prowazekii Rp22: rpr22_CDS428Help
Entry
rpr22_CDS428      CDS       T01977                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534084..534683
Genome map
AA seq 199 aa AA seqDB search
MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEIC
GNLDTKSICHICSSEYRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPR
ILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEHPAKISRLASGIPIGGEL
DYLDEGTLSAAISLRQPCE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaatgatatagatcaattaatctatcttttttcaaaattacctggtctt
ggcattagatcagcaaggcgtatagtactttatctattgcaagataaagatgtaaggcta
aaaagcctaattaatcatcttatagagctcgataagaaaatagtaaaatgcgagatttgt
ggtaatttggatacaaaaagtatttgccatatttgttcttctgaatatagagataaatcg
actatcgctattgttgaaaccgtagctgaattatgtgcaatggagcgtagtggtaatttt
aaaggtttatatcatgtactcggtcataatttatctgcagctagtagacagaaccctcgc
atacttcgtttacctgaattacttaaaagatgttttgtagaaaatattaaagaagttatt
attgcgactaattctactttagaaggtcagactactgcttattttattatagaatattta
aaagaacatcctgctaaaatttctcgccttgcaagcggtatacctattggaggtgaactt
gactatttagatgaaggcaccttatctgctgctattagcctacgtcaaccttgtgaataa

DBGET integrated database retrieval system