KEGG   Rickettsia prowazekii Rp22: rpr22_CDS511Help
Entry
rpr22_CDS511      CDS       T01977                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
rpq00010  Glycolysis / Gluconeogenesis
rpq00020  Citrate cycle (TCA cycle)
rpq00620  Pyruvate metabolism
rpq01100  Metabolic pathways
rpq01110  Biosynthesis of secondary metabolites
rpq01120  Microbial metabolism in diverse environments
rpq01130  Biosynthesis of antibiotics
rpq01200  Carbon metabolism
Module
rpq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rpr22_CDS511 (pdhC)
   00020 Citrate cycle (TCA cycle)
    rpr22_CDS511 (pdhC)
   00620 Pyruvate metabolism
    rpr22_CDS511 (pdhC)
Enzymes [BR:rpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     rpr22_CDS511 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADE30058
UniProt: D5AXB9
Position
complement(654696..655922)
Genome map
AA seq 408 aa AA seqDB search
MPIKILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII
IPQNSQNVPVNSLIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNVEGI
KHDSNKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSYDSSTSSNKIVYRDTEE
YRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVN
DFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVTPIVKDANKKNIIEL
SREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRA
IVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttgtctccaactatgagagaggggaatctagct
aggtggttaaaaaaagaaggggacaaagtaaatcccggggaagtaattgctgaaattgaa
actgataaagcaacaatggaagtagaatcagtagacgaaggtatacttgccaaaataatt
attccgcaaaatagtcaaaatgtacctgttaactctttaattgcagtattaagtgaagaa
ggagaagataaagcagatattgattcgtttattgcacaaaataatagtgtatcactatca
ctaaaaacagatgctactcttaagaaatcaaatgatagcataactaatgtagaaggtata
aaacatgattccaataaaatatttgcctcaccacttgcaaaaaggcttgcaaaaattgga
gatattagacttgagaatgtgcaaggtagtggaccgcacggtagaatagtcaaacaagat
atattatcatatgattctagcacttcttctaataaaatagtgtatagagatactgaagaa
tatcgttcagtaccaaataataatatccgaaagattatagccaagcgtttgcttgaatcg
aaacaaacagttccacatttttatttatctatagaatgtaatgttgataaattattagat
gtaagggaagacattaataaatctttttctgaagataaagtaacaaagatatcggttaat
gattttataattttagctgtagccaaagctttacaagaagtgccaaatgctaatgctagc
tggtcagaagatgcgattagatattacaataatgtcgatatttcagtggcggtagcaatc
gagaacggtattgttacaccgatagttaaagatgctaacaaaaagaatattatagaacta
tctcgtgaaatgaaaacattaataaagaaagcaaaagataataaattaactcctatagaa
tttcagggtggaggatttacaatttctaatctcggaatgtacggtattaagaattttaat
gctattattaatacaccgcaaagttgtataatgggtgtcggagctagtacaaaacgtgct
atagtcaagaatgatcaaataatcatcgcaacaattatggatgttactctttctgccgat
caccgagtaatagacggagcagtaagtgctgagttcttggcatcatttaaaaggtttata
gagaatcctgttttgatgttgatataa

DBGET integrated database retrieval system