KEGG   Rickettsia prowazekii Rp22: rpr22_CDS537Help
Entry
rpr22_CDS537      CDS       T01977                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
rpq00071  Fatty acid degradation
rpq00280  Valine, leucine and isoleucine degradation
rpq00281  Geraniol degradation
rpq00310  Lysine degradation
rpq00362  Benzoate degradation
rpq00380  Tryptophan metabolism
rpq00640  Propanoate metabolism
rpq00650  Butanoate metabolism
rpq00903  Limonene and pinene degradation
rpq00930  Caprolactam degradation
rpq01040  Biosynthesis of unsaturated fatty acids
rpq01100  Metabolic pathways
rpq01110  Biosynthesis of secondary metabolites
rpq01120  Microbial metabolism in diverse environments
rpq01130  Biosynthesis of antibiotics
rpq01200  Carbon metabolism
rpq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    rpr22_CDS537 (fadB)
   00650 Butanoate metabolism
    rpr22_CDS537 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    rpr22_CDS537 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    rpr22_CDS537 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    rpr22_CDS537 (fadB)
   00310 Lysine degradation
    rpr22_CDS537 (fadB)
   00380 Tryptophan metabolism
    rpr22_CDS537 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    rpr22_CDS537 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    rpr22_CDS537 (fadB)
   00281 Geraniol degradation
    rpr22_CDS537 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    rpr22_CDS537 (fadB)
   00930 Caprolactam degradation
    rpr22_CDS537 (fadB)
Enzymes [BR:rpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     rpr22_CDS537 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     rpr22_CDS537 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     rpr22_CDS537 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_Gly3P_dh_N NAD_binding_2 UDPG_MGDP_dh_N ApbA NAD_binding_8 Pyr_redox_2 DAO F420_oxidored Epsilon_antitox
Motif
Other DBs
NCBI-ProteinID: ADE30094
UniProt: D5AXF5
Position
complement(698646..700808)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHQVVLLDILDKDSNDPNKIVKNSVKNLHKQKL
SPLSFPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKKLKVNLPNNIKSRFVITHFFNPPRYMELVELIIDHTIKDEVIEKVSVFLTKM
LGKTIIKCNDTPGFIANRVGCFLLELVVHKAIAQNLNFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLISALPKSDDYHRIYTNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNSLNELLSSNSIYGKFFSEIITEFYIYLTSLVPSVT
NNIYDIDTTMKLGYSWHYGPFELLTIAVKNGWNLIIKNADLMNIPLPKYLASKEYQKIDK
QKFNSKKDFLQESKIVLSNDSANLIHYCENLVFVITTKMNSLNHNVFYLLQEAVSKAENY
GKNLYIYPQGNNFSAGADLKLILSYIQDGNFHNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPGWTGVTEMFARSNGNKTKLIRNIK
NIIEQNKTSSADYFKADYGIKNMQVNMNKHYILDDALKLRISKKIVSIPNKITLPKINIV
SEIDTSKYNELQNKVLNKFQNIIDKHNEISEAELLTYEREMFLELAKTPQTIEKLQAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagtcatgggttcaggcatt
gcagcgttgattgctaattcctctcatcaagtagttctgcttgatattcttgataaagat
tctaatgatcctaataaaatagtaaaaaattctgtaaagaatttgcataaacaaaagctt
tctcctttatcttttccagataaagtcaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttatcgttgagaagttagaaatc
aaacatcaattatataataaaattataccttatcttaaagaagacgcaattatcgcttct
aacacctctacattgccgctaaaaaaactcaaagtgaatttaccaaataatataaagtca
agattcgttattacacatttctttaatccaccgcgatatatggaattggttgaattaatt
atagaccatacaatcaaggatgaggtcatagaaaaagtatcagtgttcttaactaaaatg
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtagga
tgttttttacttgagttagtagtccacaaagcgatagctcaaaatcttaattttgttaca
atagatcaaatattcagtagatgtttaggtttgccgaataccggaatttttggtttatat
gatttaataggtcatgacgtaatgaagttgatatcaagttcattaatttctgctttacct
aaaagtgatgattatcataggatatatactaataccaaagtgtttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aagaagattaaagaagtgattaatataagtgatttatcatatcaccctgttcaaaaagta
gatatttcgtttaatagtctcaatgagttgctatctagcaattcaatttatggtaagttt
tttagtgagattattacagaattttatatttatttaacaagtttagtaccatccgtgact
aataatatctacgatatcgataccactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaatttgataattaaaaatgctgat
ttaatgaatattccactgcctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtaaaatagtattatcgaatgat
tctgcaaatttaatacattattgtgagaatttagtatttgttattactacgaaaatgaat
agtttaaatcataacgtattttacttattgcaagaagccgtaagtaaagcagaaaattat
ggaaaaaatctttatatttatccacaaggaaataatttttctgcaggtgcggatttaaag
cttattctttcttatattcaagatgggaattttcataatttagagaatttactaaagctt
ggacaacaaacaatgcgttatttaaaatattcttcggtacatattattagctgtgctcgt
ggtgttgcacttggaggcgggtgtgaacttctattgaactcaagctatattgtagcaaat
caggagcttaatgctggacttatagagcttggagtaggtttaataccaggatggaccggt
gttacagaaatgtttgcccgaagtaatggaaataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatggtata
aagaatatgcaagtcaatatgaacaagcattatattttagatgacgctttgaaactcaga
atatctaaaaaaatagtctccataccgaataaaattactttacctaaaattaatatagtt
agtgaaatagatacatcaaaatataacgagctacaaaataaggtacttaataaatttcag
aatattattgataaacataatgaaataagtgaagcagaattactgacatatgagcgtgaa
atgtttttagaacttgcaaaaacaccacaaactatagagaaattgcaagcgattgtgggg
taa

DBGET integrated database retrieval system