KEGG   Rickettsia prowazekii Rp22: rpr22_CDS537Help
Entry
rpr22_CDS537      CDS       T01977                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rpr22_CDS537 (fadB)
   01212 Fatty acid metabolism
    rpr22_CDS537 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    rpr22_CDS537 (fadB)
   00650 Butanoate metabolism
    rpr22_CDS537 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    rpr22_CDS537 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    rpr22_CDS537 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    rpr22_CDS537 (fadB)
   00310 Lysine degradation
    rpr22_CDS537 (fadB)
   00380 Tryptophan metabolism
    rpr22_CDS537 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    rpr22_CDS537 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    rpr22_CDS537 (fadB)
   00281 Geraniol degradation
    rpr22_CDS537 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    rpr22_CDS537 (fadB)
Enzymes [BR:rpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     rpr22_CDS537 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     rpr22_CDS537 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     rpr22_CDS537 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(698646..700808)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHQVVLLDILDKDSNDPNKIVKNSVKNLHKQKL
SPLSFPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKKLKVNLPNNIKSRFVITHFFNPPRYMELVELIIDHTIKDEVIEKVSVFLTKM
LGKTIIKCNDTPGFIANRVGCFLLELVVHKAIAQNLNFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLISALPKSDDYHRIYTNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNSLNELLSSNSIYGKFFSEIITEFYIYLTSLVPSVT
NNIYDIDTTMKLGYSWHYGPFELLTIAVKNGWNLIIKNADLMNIPLPKYLASKEYQKIDK
QKFNSKKDFLQESKIVLSNDSANLIHYCENLVFVITTKMNSLNHNVFYLLQEAVSKAENY
GKNLYIYPQGNNFSAGADLKLILSYIQDGNFHNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPGWTGVTEMFARSNGNKTKLIRNIK
NIIEQNKTSSADYFKADYGIKNMQVNMNKHYILDDALKLRISKKIVSIPNKITLPKINIV
SEIDTSKYNELQNKVLNKFQNIIDKHNEISEAELLTYEREMFLELAKTPQTIEKLQAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagtcatgggttcaggcatt
gcagcgttgattgctaattcctctcatcaagtagttctgcttgatattcttgataaagat
tctaatgatcctaataaaatagtaaaaaattctgtaaagaatttgcataaacaaaagctt
tctcctttatcttttccagataaagtcaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttatcgttgagaagttagaaatc
aaacatcaattatataataaaattataccttatcttaaagaagacgcaattatcgcttct
aacacctctacattgccgctaaaaaaactcaaagtgaatttaccaaataatataaagtca
agattcgttattacacatttctttaatccaccgcgatatatggaattggttgaattaatt
atagaccatacaatcaaggatgaggtcatagaaaaagtatcagtgttcttaactaaaatg
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtagga
tgttttttacttgagttagtagtccacaaagcgatagctcaaaatcttaattttgttaca
atagatcaaatattcagtagatgtttaggtttgccgaataccggaatttttggtttatat
gatttaataggtcatgacgtaatgaagttgatatcaagttcattaatttctgctttacct
aaaagtgatgattatcataggatatatactaataccaaagtgtttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aagaagattaaagaagtgattaatataagtgatttatcatatcaccctgttcaaaaagta
gatatttcgtttaatagtctcaatgagttgctatctagcaattcaatttatggtaagttt
tttagtgagattattacagaattttatatttatttaacaagtttagtaccatccgtgact
aataatatctacgatatcgataccactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaatttgataattaaaaatgctgat
ttaatgaatattccactgcctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtaaaatagtattatcgaatgat
tctgcaaatttaatacattattgtgagaatttagtatttgttattactacgaaaatgaat
agtttaaatcataacgtattttacttattgcaagaagccgtaagtaaagcagaaaattat
ggaaaaaatctttatatttatccacaaggaaataatttttctgcaggtgcggatttaaag
cttattctttcttatattcaagatgggaattttcataatttagagaatttactaaagctt
ggacaacaaacaatgcgttatttaaaatattcttcggtacatattattagctgtgctcgt
ggtgttgcacttggaggcgggtgtgaacttctattgaactcaagctatattgtagcaaat
caggagcttaatgctggacttatagagcttggagtaggtttaataccaggatggaccggt
gttacagaaatgtttgcccgaagtaatggaaataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatggtata
aagaatatgcaagtcaatatgaacaagcattatattttagatgacgctttgaaactcaga
atatctaaaaaaatagtctccataccgaataaaattactttacctaaaattaatatagtt
agtgaaatagatacatcaaaatataacgagctacaaaataaggtacttaataaatttcag
aatattattgataaacataatgaaataagtgaagcagaattactgacatatgagcgtgaa
atgtttttagaacttgcaaaaacaccacaaactatagagaaattgcaagcgattgtgggg
taa

DBGET integrated database retrieval system