KEGG   Rickettsia prowazekii Madrid E: RP179Help
Entry
RP179             CDS       T00018                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RP179
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RP179
  Amino acid metabolism
   00310 Lysine degradation
    RP179
Enzymes [BR:rpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RP179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212767..213972)
Genome map
AA seq 401 aa AA seqDB search
MSVKIIIPSLGESVTEATIAKWYKKLGDSVKTDELLLEIETEKVTLEVNAPCNGTIEKIA
KTDGANVTVGEEIGEINEVVDTDTACTNNNSYKKQAIVQHDSEQIVDKPASSSNILAPSV
QKLVTENKLDPNNIKGTGRGGRITKCDVLETINTTPVTIETPALNKTNEERTQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIE
ALKLIPSINAEIDGDDLLYKNYYDIGVAVGTDQGLVVPVVRDADKMGFADVEQAIGDLAK
KAREGKLSMSDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaaattataataccatcgcttggggaatcagtaacagaagcaactattgct
aaatggtataagaaattaggtgattcagttaaaactgatgaattactattagaaatcgaa
actgaaaaagtgactttagaagttaatgctccttgcaacggtactatagagaaaatagca
aaaactgatggtgcaaatgtaacagttggcgaagaaataggtgaaatcaatgaagttgta
gatacagatactgcttgtactaataataattcttataaaaagcaagcaattgtacaacac
gattcagaacagattgtagataaacctgcttcttctagtaatattcttgctccttcagta
caaaaattagtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggt
ggtagaattactaaatgtgatgtgctagaaaccataaacactacacctgttactattgag
actcctgcactaaataaaactaatgaagaaagaacacaacgcgtacgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatactgcagctattttgactact
tttaacgaaatcgatatgtcaaaagtcattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcatactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaa
gctttaaagcttattccatcaataaatgcggaaatagatggagatgatttattatataag
aactattacgatataggtgttgcagtaggaacagatcaaggacttgttgtaccagttgtt
agggatgccgataaaatgggttttgctgatgtagagcaagctatcggagatttggcaaaa
aaagctcgtgaggggaaactttctatgtctgatttgtcaggtggtacattctcaatttct
aatggaggagtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccaatgatgtatatagccttatcttacgatcatcgtataattgatggaaaagaggga
gtatcattcttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaac
ttgtag

DBGET integrated database retrieval system