KEGG   Rickettsia prowazekii Madrid E: RP253Help
Entry
RP253             CDS       T00018                                 

Definition
cytochrome C (cycM)
Orthology
K08738  
cytochrome c
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rpr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RP253
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RP253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309905..310432)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system