KEGG   Rickettsia prowazekii Madrid E: RP385Help
Entry
RP385             CDS       T00018                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RP385 (ruvA)
Enzymes [BR:rpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RP385 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472908..473507
Genome map
AA seq 199 aa AA seqDB search
MIGKLNGKIDSHCDDYVIIDVNGVGYLVYASGKTLAKLVEGKFYKLFIETHVREEHIHLY
GFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIQIAINNDDRNIFKAISGVGAKLA
ERIMLELKDKITKIFSSSAIIKDSNISSIAINEVMKALVNLGFTRFEAQNTVQGIITQNP
KISIDELIKTALKNRNSSF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaaatggtaagattgattcacactgtgatgattatgtaataatcgat
gtaaacggggtaggttatcttgtgtatgcttcaggtaagaccttagcgaaacttgtggaa
ggtaagttttataaactattcatcgaaacccatgttagagaggaacatattcatctttac
ggttttctaactctagaagagaaaaatttttttaatttgctgcaatctgttaatggtatt
ggtacaaaaatggctttgtctatcttatcaaatcttactcctacggatattcagatcgct
ataaataatgatgatagaaatatatttaaagcaatatctggagttggtgctaagcttgct
gaacgtataatgctagaattgaaagataaaataacgaaaatatttagcagctctgctatt
attaaagatagtaacatttcatctattgcaattaatgaagtaatgaaagcattagtaaat
ctaggatttactcgatttgaagctcaaaacactgttcaaggcataattacccaaaatcct
aaaatctccattgatgaactaattaaaacagcattaaaaaatcgtaattctagtttttaa

DBGET integrated database retrieval system