KEGG   Rickettsia prowazekii Madrid E: RP438Help
Entry
RP438             CDS       T00018                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534089..534769
Genome map
AA seq 226 aa AA seqDB search
MIKSFKTCLTLFQIKFLTVYKLFIIIIMNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLL
QDKDVRLKSLINHLIELDKKIVKCEICGNLDTKSICHICSSEYRDKSTIAIVETVAELCA
MERSGNFKGLYHVLGHNLSAASRQNPRILRLPELLKRCFVENIKEVIIATNSTLEGQTTA
YFIIEYLKEHPAKISRLASGIPIGGELDYLDEGTLSAAISLRQPCE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaagctttaagacatgtttaacactttttcaaattaaatttcttaccgtatac
aaactctttattataattataatgaataaaacaaatgatatagatcaattaatctatctt
ttttcaaaattacctggtcttggcattagatcagcaaggcgtatagtactttatctattg
caagataaagatgtaaggctaaaaagcctaattaatcatcttatagagctcgataagaaa
atagtaaaatgcgagatttgtggtaatttggatacaaaaagtatttgccatatttgttct
tctgaatatagagataaatcgactatcgctattgttgaaaccgtagctgaattatgtgca
atggagcgtagtggtaattttaaaggtttatatcatgtactcggtcataatttatctgca
gctagtagacagaaccctcgcatacttcgtttacctgaattacttaaaagatgttttgta
gaaaatattaaagaagttattattgcgactaattctactttagaaggtcagactactgct
tattttattatagaatatttaaaagaacatcctgctaaaatttctcgccttgcaagcggt
atacctattggaggtgaacttgactatttagatgaaggcaccttatctgctgctattagc
ctacgtcaaccttgtgaataa

DBGET integrated database retrieval system