KEGG   Rickettsia prowazekii Madrid E: RP512Help
Entry
RP512             CDS       T00018                                 

Gene name
nrdF
Definition
ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633149..634123)
Genome map
AA seq 324 aa AA seqDB search
MSLLDASPIYKPFSYPWAYEAWHTQQKIHWLPEEVPLAYDVKDWKYNLTPGEKHLLTQIF
RFFTQADIEVNNCYMKHYSRVFKPTEVLMMLSAFSNMETVHIAAYSHLLDTVGMPEVEYS
AFLKYKEMKDKYDYMQQFGVDNKEDIATTLAVFGAFTEGLQLFASFAIMLNFPRFNKMKG
MGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFIELA
FEVGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVEHTNFFEN
RATEYSKAATTGSWEEVFAEMDNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacttgatgcaagtccaatttataaaccattttcatatccatgggcatatgaa
gcttggcacactcaacaaaaaattcattggttaccagaagaagtgccactggcatacgat
gttaaagattggaaatataatttaactccaggggaaaaacatttattaactcaaatattt
cgtttttttactcaagcggatattgaagtgaataactgctatatgaaacattattcaaga
gtatttaaaccaactgaagtattaatgatgttatcagctttttctaatatggaaacagta
catattgcagcgtattcacatttacttgatactgtaggtatgccggaagtagaatattca
gcatttcttaaatataaagaaatgaaagataaatatgattatatgcagcaattcggtgtt
gataataaagaagacatagcaactacacttgcagtgttcggagcttttacggaaggatta
caattatttgcttcttttgcgattatgcttaatttccctcgttttaataaaatgaaaggt
atgggacagattattgcttggtcagttcgtgatgaaacactccatactaactcaattatt
acgctgtttaagacttttgtaagagaaaatcctgaagtttggactgaaactctacgtaaa
cgtatttatgaagcatgtacaactattgtgcattttgaagatgcttttattgaacttgct
tttgaagttggcggtattgaagggttaacggcatatgaagtaagacaatatattcgttat
attgctgatcgtcgtttaatgcaattaggacttaaagatgtatatttggtaaatcataac
cctcttccttggcttgatgaaatgttaaatggagttgagcatacgaatttttttgaaaat
agagcaactgaatattctaaagcagcaactaccggttcatgggaagaagtttttgctgaa
atggataataaatag

DBGET integrated database retrieval system