KEGG   Rickettsia prowazekii Madrid E: RP539Help
Entry
RP539             CDS       T00018                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RP539
Enzymes [BR:rpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RP539
Exosome [BR:rpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RP539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667444..668436)
Genome map
AA seq 330 aa AA seqDB search
MYPLIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNEMQEIKTMPGIYRLSIDQI
VETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTIIKIKNANIDIGIICDV
ALDPYTISGHDGIVHHGEVDNDRSVKALCNQALVLAKAGVDIVAPSDMMDGRIAAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSYQIDVRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAETGAIDWERALIES
LISFKRAGATGIFTYAALEVAEILKHNNIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcttattagatttagaagaaatagaaaagctttatggcttagagagttaata
gcagagagtaatttatcgattagtgatttagtgttacctttatttgttgttgaaggccat
aatgaaatgcaagaaattaagactatgcctggtatatatcgtttatcgatcgatcagata
gttgaaactgcaaaaaaagcagcagattttggtattaatgcgattgcattatttcctagt
attgatcacagtctaaaaagtgacaatgcagatgaggcatataatttagataatttaata
tgtagaactattataaaaatcaaaaacgccaatattgacattggtataatatgtgatgta
gcacttgatccttacactataagtggccatgatggtattgttcatcatggagaagttgat
aatgataggtcagtaaaagctttatgtaatcaagcattagtattagcaaaagctggagta
gatatcgttgcaccttctgatatgatggatggaagaatagcagctatcagggagtatctt
gacaaagaaggctttataaatgtaggaattcttgcttatgcagctaaatatgcttcaagc
ttttatggcccatttcgcgatgcagttcagagtaataaaaagaattatttagataaatca
agctatcaaattgatgtgcgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagaaggagcagatattgtaatggttaaaccaggtatgccgtttttggatgtgattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggttagtggggaatacgca
atgttaaaatttgcagcagaaacaggggctattgattgggagagagcgttaatagaatca
ttaattagttttaaacgtgccggtgcaacaggaatatttacctatgctgctcttgaagta
gctgaaatattaaagcacaataacattaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system