KEGG   Rickettsia prowazekii Madrid E: RP765Help
Entry
RP765             CDS       T00018                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(958122..958715)
Genome map
AA seq 197 aa AA seqDB search
MKFKNKGLIIILSSPSGTGKSSLAKELLKIDNNLRLSISVTTRKPRLGEVDGINYYFKSD
REFKTLVKQNKFLEYAKIYNDYYGTPKEYVKMLLKQGFDVLFDIDWQGVRSIKKNTNNVI
TIFILPPSIEILEQRLRNRATDNEETIKLRMQSAQNEISHANEYDYVVINDDFSQTLKKI
HEIIVAERAKNFAYHEY
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaaataaaggactgattataattttatcttctccttcaggtactggtaag
tcaagtttagctaaagaattattgaaaatagataataatttacgtttatctatttcagtc
actacaaggaaaccacgtttaggagaagtagatggtataaactattactttaaaagtgat
cgagagtttaaaacattagttaaacagaataaattccttgaatatgctaaaatatacaat
gattattatggtactcctaaagaatatgttaaaatgttattaaagcaaggctttgatgtt
ttattcgatattgattggcaaggagtcaggagtattaagaaaaatactaataatgttatt
actatatttatattgcctcctagtattgaaatactggaacaacgcttaagaaatagagcg
acagataatgaagaaacaatcaaattgcgtatgcagtcggcacaaaatgaaatatcgcac
gctaatgagtatgactatgtagttattaacgatgatttcagtcaaacgcttaaaaaaata
catgagattatagttgcagaaagagcaaagaattttgcttaccatgaatattag

DBGET integrated database retrieval system