KEGG   Rickettsia prowazekii Madrid E: RP874Help
Entry
RP874             CDS       T00018                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rpr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098565..1099716)
Genome map
AA seq 383 aa AA seqDB search
MYTHYLKNLVSFKSVTPNSAGAIEYIDDLLKQHSFKTEIKIFGDSKKEQVTNLYAIFGGN
EPNICFVGHVDVVPAGNYEFWHNSNPFKFHEQDGKIYGRGTVDMKGAIACFLAASLNFIK
NNTDFKGSISFLITSDEEGKSKHGTKEMLQYIYDQRYKIDFAVVGEPTCEKEIGDTIKIG
RRGSVNFKLNIVGLAGHVAYPHKANNPLPCLIKILNELINIKLDEGTEFFQNSNLEVTNI
DVDNDTSNTIPASAAAHFNIRFNSLHNVETLRQLIEQIIKQYCKEYKVDYKLEYSSSAES
FIQNPNDNDKIKKFANVIERTLKIKSKFSTSGGTSDARFVKDYCSLVEFGLLSDMAHKIN
EYTKISDLQKLYNVYYNFLIEIL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtacactcattatttaaaaaacttagtcagctttaagtcagtaacgcctaatagtgct
ggagctattgaatatattgatgatttgctcaagcaacacagttttaaaactgaaataaaa
atatttggtgattctaaaaaagagcaagtcactaacctttatgctatttttggtggtaac
gagcctaatatttgctttgttggtcatgtagatgtagtaccggctggcaattatgagttt
tggcataattctaatccatttaaatttcatgagcaagatggaaagatatatggaagaggt
acggtagatatgaaaggtgccatagcatgctttttagctgctagtttaaattttataaaa
aataataccgattttaaaggttcaattagtttcttgattactagtgatgaagagggaaaa
tcaaaacatggtactaaagaaatgttacaatatatttatgatcaaagatataagatagat
tttgccgttgttggtgaacccacttgtgaaaaagaaataggtgatacgattaagatcggt
agaagaggaagtgttaactttaaattaaatatagtaggtttagctgggcatgtagcttat
cctcataaagcaaataatccattaccttgcttaattaaaatattgaatgagttaataaat
ataaaacttgatgaaggtactgaattttttcaaaattcaaatcttgaagtaacaaatatt
gatgttgataatgatacctcaaataccattccagcaagtgcagcagcacactttaatata
cgttttaatagtttacataatgtagaaactttaaggcaattaatagagcaaattataaaa
caatattgtaaagaatataaagtagattataagctagaatatagtagttctgctgaaagt
tttattcaaaatcctaacgataatgataaaataaaaaaatttgctaatgtaatagagaga
acgttaaaaataaaatctaaattttctacaagcggtggtacatcagatgcaaggtttgtt
aaagattattgttccttagtagagttcggtttattatctgatatggcacataaaataaat
gaatataccaaaattagcgatttacaaaaattatataatgtgtattataactttttgata
gaaatactttga

DBGET integrated database retrieval system