KEGG   Rickettsia prowazekii Katsinyian: M9Y_00610Help
Entry
M9Y_00610         CDS       T01792                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
rps00020  Citrate cycle (TCA cycle)
rps00190  Oxidative phosphorylation
rps00650  Butanoate metabolism
rps01100  Metabolic pathways
rps01110  Biosynthesis of secondary metabolites
rps01120  Microbial metabolism in diverse environments
rps01130  Biosynthesis of antibiotics
rps01200  Carbon metabolism
Module
rps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M9Y_00610
   00650 Butanoate metabolism
    M9Y_00610
  Energy metabolism
   00190 Oxidative phosphorylation
    M9Y_00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS PAP2 Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFE49796
Position
149931..150308
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system