KEGG   Rickettsia prowazekii Katsinyian: M9Y_01240Help
Entry
M9Y_01240         CDS       T01792                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rps00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    M9Y_01240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M9Y_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309906..310433)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system