KEGG   Rickettsia prowazekii Katsinyian: M9Y_01240Help
Entry
M9Y_01240         CDS       T01792                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
rps01100  Metabolic pathways
rps01120  Microbial metabolism in diverse environments
rps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rps00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M9Y_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF5326
Motif
Other DBs
NCBI-ProteinID: AFE49918
Position
complement(309906..310433)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system