KEGG   Rickettsia prowazekii Katsinyian: M9Y_02135Help
Entry
M9Y_02135         CDS       T01792                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M9Y_02135 (recR)
DNA repair and recombination proteins [BR:rps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M9Y_02135 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534173..534772
Genome map
AA seq 199 aa AA seqDB search
MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEIC
GNLDTKSICHICSSEYRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPR
ILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEHPAKISRLASGIPIGGEL
DYLDEGTLSAAISLRQPCE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaaatgatatagatcaattaatctatcttttttcaaaattacctggtctt
ggcattagatcagcaaggcgtatagtactttatctattgcaagataaagatgtaaggcta
aaaagcctaattaatcatcttatagagctcgataagaaaatagtaaaatgcgagatttgt
ggtaatttggatacaaaaagtatttgccatatttgttcttctgaatatagagataaatcg
actatcgctattgttgaaaccgtagctgaattatgtgcaatggagcgtagtggtaatttt
aaaggtttatatcatgtactcggtcataatttatctgcagctagtagacagaaccctcgc
atacttcgtttacctgaattacttaaaagatgttttgtagaaaatattaaagaagttatt
attgcgactaattctactttagaaggtcagactactgcttattttattatagaatattta
aaagaacatcctgctaaaatttctcgccttgcaagcggtatacctattggaggtgaactt
gactatttagatgaaggcaccttatctgctgctattagcctacgtcaaccttgtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system