KEGG   Rickettsia prowazekii Katsinyian: M9Y_03715Help
Entry
M9Y_03715         CDS       T01792                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M9Y_03715 (gmk)
Enzymes [BR:rps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     M9Y_03715 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(958033..958626)
Genome map
AA seq 197 aa AA seqDB search
MKFKNKGLIIILSSPSGTGKSSLAKELLKIDNNLRLSISVTTRKPRLGEVDGINYYFKSD
REFKTLVKQNKFLEYAKIYNDYYGTPKEYVKMLLKQGFDVLFDIDWQGVRSIKKNTNNVI
TIFILPPSIEILEQRLRNRATDNEETIKLRMQSAQNEISHANEYDYVVINDDFSQTLKKI
HEIIVAERAKNFAYHEY
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaaataaaggactgattataattttatcttctccttcaggtactggtaag
tcaagtttagctaaagaattattgaaaatagataataatttacgtttatctatttcagtc
actacaaggaaaccacgtttaggagaagtagatggtataaactattactttaaaagtgat
cgagagtttaaaacattagttaaacagaataaattccttgaatatgctaaaatatacaat
gattattatggtactcctaaagaatatgttaaaatgttattaaagcaaggctttgatgtt
ttattcgatattgattggcaaggagtcaggagtattaagaaaaatactaataatgttatt
actatatttatattgcctcctagtattgaaatactggaacaacgcttaagaaatagagcg
acagataatgaagaaacaatcaaattgcgtatgcagtcggcacaaaatgaaatatcgcac
gctaatgagtatgactatgtagttattaacgatgatttcagtcaaacgcttaaaaaaata
catgagattatagttgcagaaagagcaaagaattttgcttaccatgaatattag

DBGET integrated database retrieval system