KEGG   Rickettsia prowazekii Katsinyian: M9Y_04235Help
Entry
M9Y_04235         CDS       T01792                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M9Y_04235
   00240 Pyrimidine metabolism
    M9Y_04235
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    M9Y_04235
   03430 Mismatch repair
    M9Y_04235
   03440 Homologous recombination
    M9Y_04235
Enzymes [BR:rps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     M9Y_04235
DNA replication proteins [BR:rps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     M9Y_04235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1097769..1098233)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYHTSNELFLKAILRLIEKCYYSNFKSVILTTDVHQQEMLNKNLWTYSRKQFIPH
GSKFDPQPAKQPIYITDELQNPNNASVLVIISPTDIAKILQVKEYIKVFKRIIIITDLLE
NLKELIIKINKFTGQENKIDCFTQNPIGTWNKIA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcacacaagcaacgaattgtttctaaaagcaatattacgt
cttatagaaaaatgttattactctaattttaaaagtgtgatattaactacagatgtacat
caacaagaaatgctcaataaaaatctttggacttattcacgtaaacagtttatacctcat
ggtagtaaatttgatccgcagcctgcaaaacaacctatttatattacagatgagttacaa
aatcctaataatgctagtgttcttgttattatttcacctacagatatagcaaaaatttta
caagtcaaagaatatataaaagtcttcaaaaggataattataataacagatttactggaa
aatttaaaagaattaattattaaaataaataaatttactgggcaggaaaacaaaatagat
tgttttactcaaaatcctattggaacttggaataaaatagcataa

DBGET integrated database retrieval system