KEGG   Rickettsia prowazekii Katsinyian: M9Y_04240Help
Entry
M9Y_04240         CDS       T01792                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rps  Rickettsia prowazekii Katsinyian
Pathway
rps00300  Lysine biosynthesis
rps01100  Metabolic pathways
rps01120  Microbial metabolism in diverse environments
rps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rps00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    M9Y_04240
Enzymes [BR:rps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     M9Y_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFE50511
Position
complement(1098496..1099647)
Genome map
AA seq 383 aa AA seqDB search
MYTHYLKNLVSFKSVTPNSAGAIEYIDDLLKQHSFKTEIKIFGDSKKEQVTNLYAIFGGN
EPNICFVGHVDVVPAGNYEFWHNSNPFKFHEQDGKIYGRGTVDMKGAIACFLAASLNFIK
NNTDFKGSISFLITSDEEGKSKHGTKEMLQYIYDQRYKIDFAVVGEPTCEKEIGDTIKIG
RRGSVNFKLNIVGLAGHVAYPHKANNPLPCLIKILNELINIKLDEGTEFFQNSNLEVTNI
DVDNDTSNTIPASAAAHFNIRFNSLHNVETLRQLIEQIIKQYCKEYKVDYKLEYSSSAES
FIQNPNDNDKIKKFANVIERTLKIKSKFSTSGGTSDARFVKDYCSLVEFGLLSDMAHKIN
EYTKISDLQKLYNVYYNFLIEIL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtacactcattatttaaaaaacttagtcagctttaagtcagtaacgcctaatagtgct
ggagctattgaatatattgatgatttgctcaagcaacacagttttaaaactgaaataaaa
atatttggtgattctaaaaaagagcaagtcactaacctttatgctatttttggtggtaac
gagcctaatatttgctttgttggtcatgtagatgtagtaccggctggcaattatgagttt
tggcataattctaatccatttaaatttcatgagcaagatggaaagatatatggaagaggt
acggtagatatgaaaggtgccatagcatgctttttagctgctagtttaaattttataaaa
aataataccgattttaaaggttcaattagtttcttgattactagtgatgaagagggaaaa
tcaaaacatggtactaaagaaatgttacaatatatttatgatcaaagatataagatagat
tttgccgttgttggtgaacccacttgtgaaaaagaaataggtgatacgattaagatcggt
agaagaggaagtgttaactttaaattaaatatagtaggtttagctgggcatgtagcttat
cctcataaagcaaataatccattaccttgcttaattaaaatattgaatgagttaataaat
ataaaacttgatgaaggtactgaattttttcaaaattcaaatcttgaagtaacaaatatt
gatgttgataatgatacctcaaataccattccagcaagtgcagcagcacactttaatata
cgttttaatagtttacataatgtagaaactttaaggcaattaatagagcaaattataaaa
caatattgtaaagaatataaagtagattataagctagaatatagtagttctgctgaaagt
tttattcaaaatcctaacgataatgataaaataaaaaaatttgctaatgtaatagagaga
acgttaaaaataaaatctaaattttctacaagcggtggtacatcagatgcaaggtttgtt
aaagattattgttccttagtagagttcggtttattatctgatatggcacataaaataaat
gaatataccaaaattagcgatttacaaaaattatataatgtgtattataactttttgata
gaaatactttga

DBGET integrated database retrieval system