KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0072Help
Entry
Rpal_0072         CDS       T00722                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpal_0072
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_0072
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpal_0072
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpal_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
74866..76080
Genome map
AA seq 404 aa AA seqDB search
MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEAKADPAFRAEMDNHLK
HYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAE
TGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVREQIMQAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASIAGGKPGVLHGNRTYLLMDA
DGQIEEAHSISAGLDYPGVGPEHSWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEHLGGKF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctttgccgaattccttccggtccggccccgacgagcgcgggcatttcggt
atctatggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgatctggaaaag
gcctatgcggaagccaaggccgacccggcgttccgcgccgagatggacaaccatctcaag
cactatgtcggacgtccgtcggctttgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaagatctcaatcacaccggcgctcacaaggtgaac
aacgtgctcggccagatcatgctggccaagcgcatgggcaagccgcgggtgatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgccaaattcggcctcgaa
tgcgtggtgttcatgggcgcggtcgacgtcgaacgccagcagcccaacgtgctgcggatg
aaggcgctcggcgcagaagtccgccccgtcacctccggcgccaacacgctgaaggacgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacgacacgttctattgcatcggc
acggtcgcgggtccgcatccctatccgatgatggtgcgcgacttccaggcggtgatcggt
caggaagtccgcgagcagatcatgcaggccgaaggtcgcctgcccgactcgctggtcgcc
tgcatcggcggcggctccaacgcgatggggctgttccatccgttcctcgacgatccgggc
gtcgcgatctacggcgtcgaagctgcgggccatgggctcgacaagctgcacgcggcgtcg
atcgccggcggcaagccgggcgtgctgcacggcaaccgcacctatctgctgatggatgcg
gacggccagatcgaggaagcgcattcgatctccgccggcctcgactatccgggcgtcggc
cccgagcactcctggctgcacgacgtcggccgcgtcaacttcctgtccgccaccgacacc
gaagcgctcgacgcgttcaagctgtgctgccgactcgaaggcatcatcccggcgctggag
ccgagccacgcgctcgccaaggtcgccgacctcgcgcccaagctgccgaaggatcacctg
atggtcgtgaacatgtccggccgcggcgacaaggacctcgcgtcggtcgcagaacatctc
gggggcaagttctga

DBGET integrated database retrieval system