KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0072Help
Entry
Rpal_0072         CDS       T00722                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00260  Glycine, serine and threonine metabolism
rpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01130  Biosynthesis of antibiotics
rpt01230  Biosynthesis of amino acids
Module
rpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_0072
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpal_0072
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpal_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACE98634
JGI: Rpal0072
UniProt: B3Q605
Position
74866..76080
Genome map
AA seq 404 aa AA seqDB search
MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEAKADPAFRAEMDNHLK
HYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAE
TGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVREQIMQAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASIAGGKPGVLHGNRTYLLMDA
DGQIEEAHSISAGLDYPGVGPEHSWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEHLGGKF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctttgccgaattccttccggtccggccccgacgagcgcgggcatttcggt
atctatggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgatctggaaaag
gcctatgcggaagccaaggccgacccggcgttccgcgccgagatggacaaccatctcaag
cactatgtcggacgtccgtcggctttgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaagatctcaatcacaccggcgctcacaaggtgaac
aacgtgctcggccagatcatgctggccaagcgcatgggcaagccgcgggtgatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgccaaattcggcctcgaa
tgcgtggtgttcatgggcgcggtcgacgtcgaacgccagcagcccaacgtgctgcggatg
aaggcgctcggcgcagaagtccgccccgtcacctccggcgccaacacgctgaaggacgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacgacacgttctattgcatcggc
acggtcgcgggtccgcatccctatccgatgatggtgcgcgacttccaggcggtgatcggt
caggaagtccgcgagcagatcatgcaggccgaaggtcgcctgcccgactcgctggtcgcc
tgcatcggcggcggctccaacgcgatggggctgttccatccgttcctcgacgatccgggc
gtcgcgatctacggcgtcgaagctgcgggccatgggctcgacaagctgcacgcggcgtcg
atcgccggcggcaagccgggcgtgctgcacggcaaccgcacctatctgctgatggatgcg
gacggccagatcgaggaagcgcattcgatctccgccggcctcgactatccgggcgtcggc
cccgagcactcctggctgcacgacgtcggccgcgtcaacttcctgtccgccaccgacacc
gaagcgctcgacgcgttcaagctgtgctgccgactcgaaggcatcatcccggcgctggag
ccgagccacgcgctcgccaaggtcgccgacctcgcgcccaagctgccgaaggatcacctg
atggtcgtgaacatgtccggccgcggcgacaaggacctcgcgtcggtcgcagaacatctc
gggggcaagttctga

DBGET integrated database retrieval system