KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0073Help
Entry
Rpal_0073         CDS       T00722                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00260  Glycine, serine and threonine metabolism
rpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01130  Biosynthesis of antibiotics
rpt01230  Biosynthesis of amino acids
Module
rpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_0073
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpal_0073
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpal_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth DUF561 PcrB
Motif
Other DBs
NCBI-ProteinID: ACE98635
JGI: Rpal0073
UniProt: B3Q606
Position
76080..76916
Genome map
AA seq 278 aa AA seqDB search
MTTRIDTRFADLKQQGRPALVTFVMAGDPDLDTSLQILKALPAAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLGLVRDFRATDNATPLVLMGYYNPIYIYGVDAFLADAK
AAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKRLPAVLANTSGFVYYVSI
TGITGSASADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQAIAAQANGAVVGSALIDA
LKASLDAEGRATKGTVGAVADLVASLAAGVRGAKQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcatcgacacccgcttcgctgatctgaagcagcagggccggccggcactc
gtcaccttcgtgatggcgggcgatcccgatctcgacacctcgctgcagatcctcaaggct
ctgccggctgcaggcgccgacgtgatcgagatcggcatgccgttcaccgacccgatggcg
gatggtccggcgatccaggccgccggcctgcgcgcgttgaaagccggcaccacgctgaag
aagacgctggggctggtccgcgacttccgcgccaccgacaatgccaccccgctggtgctg
atggggtattacaacccgatctacatctacggcgtcgatgccttcctggcggatgccaag
gcggccggcgtcgacggcctgatcatcgtcgacctgccgcccgaagaggacgaagagctg
tgcttgccggcgatgaaggccgggctcaacttcatccgcctcgccaccccgaccaccgac
gaaaagcggttaccggcggtgctcgccaacacttcgggcttcgtctattacgtctcgatc
accggcatcaccggatcggcctcggcggatgcctcggcggtcggcgccgcggtgcagcgg
atcaagcgtcacaccaacctgccggtctgcgtcggcttcggcatccgtacgccggatgcg
gcgcaggcgatcgccgcgcaggcgaacggcgcggtggtgggctcggcgctgatcgatgcg
ctcaaggccagcctcgacgccgaaggccgcgccaccaagggcacggtcggtgcggtggcg
gatctggtcgcctcgctcgcggccggcgttcgcggtgcgaaacaggctgcggaatag

DBGET integrated database retrieval system