KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0121Help
Entry
Rpal_0121         CDS       T00722                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00521  Streptomycin biosynthesis
rpt00523  Polyketide sugar unit biosynthesis
rpt01130  Biosynthesis of antibiotics
Module
rpt_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rpal_0121
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpal_0121
Enzymes [BR:rpt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rpal_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACE98683
JGI: Rpal0121
UniProt: B3Q6Z5
Position
133382..133939
Genome map
AA seq 185 aa AA seqDB search
MLTVTSTAIEAVKIITPRAFADSRGTFSETYNRQRFVDHGVALEFVQDNQSISAAVGTVR
GLHFQSAPFAQDKLVRVAKGRILDVAVDLRRSSPTYGQWVAEELSAEDGKQLLIPIGFAH
GFCTLEPDTVLAYKVTNYYSPPHDLGIAWNDPDLAVRWPVTADQAVLSDKDLKLPPFASL
PNYFE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagtgacgtccaccgcaatcgaggcggtgaagattatcacgccgagggcattc
gcggattcgcggggaacgttctccgaaacctacaacaggcagcgcttcgtcgatcacggt
gttgcgctcgaattcgtccaggacaaccaatcgatttcggctgcagtcggcaccgttcgc
gggctgcacttccagagcgcgccgtttgcgcaggacaagctggtgcgagtggcgaagggc
cgtatcctcgacgttgcggtcgatctgcgccggtcctcgccgacctacggccaatgggtc
gccgaagagctgtctgccgaggacggcaagcagttgctgattccgatcggtttcgcccac
ggcttctgcaccctcgaacccgacacggtgctggcctacaaggtgaccaactactattcg
ccgccgcatgatctcggcatcgcctggaacgatcccgatctagcggtacgctggcctgtc
actgccgatcaggcggtgctgtcggataaggatctgaagctgccgccgttcgcgtcactg
ccgaactacttcgagtag

DBGET integrated database retrieval system