KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0158Help
Entry
Rpal_0158         CDS       T00722                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpal_0158
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rpal_0158
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rpal_0158
Enzymes [BR:rpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rpal_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
172213..173343
Genome map
AA seq 376 aa AA seqDB search
MASPKLHDFRHIVVKVGSSLLIDSAAGEVRAGWLAALAADIAELHRGGRDVMVVSSGSIA
LGRSRLKLPRGPLKLEESQAAAAVGQIELARTWSEVLGAHGIGAGQILVTFQDTEERRRY
LNARSTIAKLLEWRAVPVINENDTVATTEIRYGDNDRLAARVATMASADLLILLSDIDGL
YTAPPGNDPDATLIPVVEAITAEIEGMAGAAGSELSRGGMRTKIEAAKIATSAGTHMLIA
SGKIDHPLRAIAEGGKCTWFLTPANPVTARKRWIAGTLEPKGTLTIDAGAVSALRAGKSL
LPAGVIRVDGQFSRGDAVIVRGPDTHEIGRGLVAYDAEDAEKIKGHSSPDVMMILGITGR
AEMIHRDDLVVGTAPT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccagccctaagcttcacgatttccgccacatcgtcgtcaaggtcggctcgtcgctg
ctgatcgactccgccgccggcgaggtgcgggccgggtggctggcggcgctcgcagccgac
attgccgagctgcatcgtggcggccgggacgtgatggtggtgtcgtcgggctcgatcgcg
ctcggacggagccggctgaagctgccgcgcggcccgctcaagcttgaggaaagccaggcc
gccgcggcggtcgggcaaatcgaactggcgcggacctggtcggaagtgctcggcgcccat
ggcatcggcgccggccagatcctggtgacgtttcaggacactgaagaacggcggcgttat
ctcaacgcccgctcgaccatcgccaaactgctggaatggcgcgcggtgccggtgatcaac
gagaacgacaccgtcgccaccaccgagatccgctacggcgataacgaccggctggcggcg
cgcgtcgccaccatggcgagcgccgatctgctgatcctgctgtccgacatcgacgggctg
tacactgcaccgcccggcaacgatccggacgccacgctgattcccgtggtcgaagcgatc
accgccgaaatcgagggcatggcaggcgctgccggctcggagctgtcgcgcggcggcatg
cggaccaagatcgaggcggccaagatcgcgacctccgccggcacccatatgctgatcgcc
tccggcaagatcgatcatccgctcagggcgatcgccgaagggggcaagtgcacctggttc
ctgacgccggccaatcccgtgacggcacgaaagcgctggattgccggcacgctggagccg
aagggcacgctgacgatcgacgccggcgcagtcagcgcgctgcgcgccggcaagagcctg
ctgccggccggcgtgatccgggtcgacggtcaattttcccgcggcgacgccgtgatcgtg
cgcggcccggacacccatgagatcggccgcggcctggtcgcttacgacgccgaggatgcc
gagaagatcaaaggccactcgtcgccggacgtgatgatgatcctcggaatcaccggccgc
gccgagatgatccatcgcgacgatctagtcgtcggaacggcgccgacctga

DBGET integrated database retrieval system