KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0183Help
Entry
Rpal_0183         CDS       T00722                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00020  Citrate cycle (TCA cycle)
rpt00310  Lysine degradation
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
Module
rpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpal_0183
  Amino acid metabolism
   00310 Lysine degradation
    Rpal_0183
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rpal_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACE98745
JGI: Rpal0183
UniProt: B3Q757
Position
complement(198491..199744)
Genome map
AA seq 417 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVAVGALLGQITDGAAPAKPAAAAPAKAAAPAAAPAPAAPAPAAAPAAKAPPSDAP
LAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRGPS
PADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFEKKH
GAKLGFMGFFTKACVQALKDIPAVNAEMDGTDLIYKNYYHIGVAVGTDKGLVVPVVRDCD
EKSIADIEKSIVDYGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGM
HKIQERPVVIGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccgacgctcggtgaatcggtgaccgaggcgaccatcggccgc
tggttcaagaagcctggtgaggcggtggctgtcgatgagccgctcgtcgagctcgaaacc
gacaaggtgaccattgaagtgccggccccgtcggccggtacgctcggcgaaatcgtcgcc
aaggacggcgagaccgttgcggtcggcgcgttgctcggccagatcaccgatggcgccgcc
ccggccaagccggctgcggctgctccggcgaaggctgcggccccggctgctgcgcctgcc
ccggcggcaccggcccccgcggctgctcccgccgccaaggctccgccgtccgatgcgccg
ctggcgccgtcggtgcgccggctgtcaaccgagagcggcgtcgacgcctcgaccgtgccg
ggctccggcaaggacggtcgcgtcaccaagggcgatatgctggcggcgatcgagaaggcg
gcctcggcgccgaccccggtcaatcagcctgccgccgcggtgcaggtccgcgggccgtct
ccggccgacgacgccgcacgcgaagagcgggtgaagatgacccggctgcgccagaccatc
gcgcgccgcctgaaggaagtgcagaacaccgccgcgatgctgacgaccttcaacgaggtc
gacatgaccaacgtcatggcgctgcgcgcgcagtacaaggacgtgttcgagaagaagcac
ggcgccaagctcggcttcatgggcttcttcaccaaggcctgcgttcaggccctgaaggat
atcccggcggtgaacgccgagatggacggcaccgacctgatctacaagaactactaccac
atcggcgtcgccgtcggcaccgacaagggtctcgtggtcccggtggtgcgcgactgcgac
gagaagtcgatcgccgacatcgaaaagagcatcgtcgactacggcaagcgtgcccgtgac
ggtcagctcaagatcgaggagatgcagggcggtaccttcacgatcactaacggcgggatc
tacggttcgctgatgtcgaccccgatcctgaacgcgccgcagtccggcatcctcggcatg
cacaagatccaggaacgcccggttgtgatcggcggcaagatcgaagtccgcccgatgatg
tatttggcgctgagctatgatcaccgcgtgatcgacggcaaggaagccgtgaccttcctg
gttcgcgtcaaggagagcctggaagacccggcgcgcctggtgctggatctctga

DBGET integrated database retrieval system