KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0186Help
Entry
Rpal_0186         CDS       T00722                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00020  Citrate cycle (TCA cycle)
rpt00640  Propanoate metabolism
rpt00660  C5-Branched dibasic acid metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
Module
rpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpal_0186
   00640 Propanoate metabolism
    Rpal_0186
   00660 C5-Branched dibasic acid metabolism
    Rpal_0186
Enzymes [BR:rpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rpal_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACE98748
JGI: Rpal0186
UniProt: B3Q760
Position
complement(203883..205079)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQLGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVNRLYIEEGSDIDKEFYL
SLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPATGIMGHHGRTVAKALNLK
GEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCLDAKISFDGNALYRHTDIQ
ALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMATMDIIKLYGMSPANFLDVG
GGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAEGVVAAVKEVGLDVPLVVRLE
GTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaaggcggtgctgcgcgagttcggtgtgccggtgggg
cacggcttcccgatcttcaaggcgtccgaagcggaagccgccgccaagcagctcggcggc
ccggtctgggtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaagcttccgccggcgacaagggcggcgttcgcctcgccaagtcgatcgacgaggtcaag
gaattcgccaagcagatgctcggcgccacgctggtgacggtgcagacgggcgccgacggc
aagcaggtcaaccgcctgtacatcgaggaaggctccgacatcgacaaggagttctacctg
tcgttgctggtcgatcgcgccacctcgcggatttccttcgtggtctcgaccgaaggcggc
atgtcgatcgaagacgttgcccacgagacgcccgagaagatcgtgtcgttcaccgtcgat
ccggcgaccggcatcatgggccatcacggccgcaccgtcgccaaggcgctgaacctcaag
ggcgagcaggccaagcaggccgaagcgatggtggcgaagctttacaccgccttcgtcgcc
aaagacatggacatgctcgagatcaacccgctggtgctgaccaagcagggcgatctgaag
tgcctcgacgccaagatctcgttcgacggcaacgcgctgtaccgccacaccgacatccag
gcgctgcgtgacgagaccgaggaagacgccaaggaaatcgaagcgtcgaaatacgacctc
aactacgtcaccctcgacggcaccatcggctgcatggtcaacggcgccggcctcgcgatg
gcgacgatggacatcatcaagctgtacggcatgagcccggccaacttcctcgacgtcggc
ggcggcgccagcaaggagaaggtgaccgcggcgttcaagatcatcactgccgatccgaac
gtgaagggcatcctgatcaacatcttcggcggcatcatgaagtgcgacgtgatcgccgaa
ggcgtggtcgcagcggtcaaggaagtcggtctcgacgtgccgctggtggtccgcctcgaa
ggcaccaatgtcgaagctggcaagaagatcatcaagcattccggcctcaacgtgctgccc
gccgacaatctcgacgacgccgcgcagaagatcgtcgccgccgtgaagggagcctga

DBGET integrated database retrieval system