KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0217Help
Entry
Rpal_0217         CDS       T00722                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00020  Citrate cycle (TCA cycle)
rpt00190  Oxidative phosphorylation
rpt00650  Butanoate metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
Module
rpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpal_0217
   00650 Butanoate metabolism
    Rpal_0217
  Energy metabolism
   00190 Oxidative phosphorylation
    Rpal_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACE98777
JGI: Rpal0217
UniProt: B3Q789
Position
complement(236477..236890)
Genome map
AA seq 137 aa AA seqDB search
MSSDAHGKRTPTSMRTPIGKVRKFGPAGSGTSDFWQQRITGVAMALLILPTIVVIMMLLG
RNQAAAAQILGSPLISLIMILFIIASAIHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSI
AVALAAIFAIFKMASGV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgacgcccacggcaagcgcacgccgacctcgatgcgcactccgatcggcaag
gtgcgcaaattcggccccgccggctccggaacctcggatttctggcagcagcgcatcacc
ggcgtcgccatggcgctgctgatcctgccgaccatcgtggtgatcatgatgctgctcggc
cgcaaccaggcggccgccgcgcagatcctcggctctccgctgatctcgctgatcatgatc
ctgttcatcattgcctccgcgatccacatgaagatcggcatgcaggtggtgatcgaggac
tacgtccagaacgaaaagctcaagttggtcaccatcatggccaacaacttcttctcgatc
gccgtggcgctggccgcgatctttgcgatcttcaaaatggcatccggagtttaa

DBGET integrated database retrieval system