KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0378Help
Entry
Rpal_0378         CDS       T00722                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00071  Fatty acid degradation
rpt00350  Tyrosine metabolism
rpt00625  Chloroalkane and chloroalkene degradation
rpt00626  Naphthalene degradation
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_0378
  Lipid metabolism
   00071 Fatty acid degradation
    Rpal_0378
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpal_0378
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpal_0378
   00626 Naphthalene degradation
    Rpal_0378
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpal_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACE98938
JGI: Rpal0378
UniProt: B3Q9B4
Position
complement(402305..403288)
Genome map
AA seq 327 aa AA seqDB search
MDAMVLTAPGTSLQWQSRDTPQPGDGEVLVTVSACGVCRTDLHVVDGELPNIRYPIIPGH
EIVGRVAAVGAGVTTHQIGDRVGIPWLGHTCGLCRYCRSGMENLCDAPLFTGYTRDGGFA
SHAIADARYAFPLGEAGDDVAIAPLLCAGLIGWRSLAIAGDAERLGIYGFGAAGHIVAQV
ARWQGRQVYAFTRGGDVAAQDFARSLGAMWAGASEELPPEPLDAAIIYAPVGSLVPAALK
AVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQDGVDFLEVAQQAGIRTETH
AFPLREANTVLNKLRAGELLGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatggtgctgacagcaccgggcacgtcgctgcaatggcaatcgcgcgacacg
ccgcagccgggtgacggcgaggtgctggtcacggtgagcgcttgcggcgtctgccgcact
gaccttcacgtcgtcgatggcgaattgccgaacatccgttatccgatcattcccggccat
gagatcgtcggccgcgtcgcggcggtcggcgctggcgtcaccacacatcagatcggtgac
cgcgtcggcattccctggctcggccacacttgtgggctgtgccggtactgccgaagcggc
atggagaatctgtgcgatgcgccgctgttcaccggctacacccgcgacggcggatttgcg
tctcacgccatcgccgacgcgcgctacgcgtttccgctcggcgaggccggcgatgacgtt
gcgattgcgccgctgctgtgcgccggactgatcggctggcgttcgctggcgatcgccgga
gacgcagagcggctcggaatctacggcttcggcgccgccggccatatcgtggcgcaggtc
gcgcgctggcaaggacggcaggtgtacgccttcacccgcggcggcgatgtcgcggctcag
gacttcgcccgcagcctcggcgcaatgtgggccggcgcctcggaagaattgccgcccgag
ccgctcgacgccgcgatcatctacgcgccggtcggcagcctggtgccggccgcgctgaag
gcggtgcgcaaaggcggccgcgtggtgtgcgccggcatccatatgagcgacatcccgagc
tttccgtatgacctgctgtgggaggaacgccagctcgtttcggtcgccaacctcacccgg
caggacggtgtcgattttcttgaggtggcgcagcaggccggcatccggaccgagacccac
gccttcccgctacgtgaggccaacacggtattgaacaaactccgcgccggcgaactgctc
ggtgcggcggtgctggtgccatag

DBGET integrated database retrieval system