KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0383Help
Entry
Rpal_0383         CDS       T00722                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpal_0383
   01230 Biosynthesis of amino acids
    Rpal_0383
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_0383
   00030 Pentose phosphate pathway
    Rpal_0383
   00051 Fructose and mannose metabolism
    Rpal_0383
   00052 Galactose metabolism
    Rpal_0383
  Energy metabolism
   00680 Methane metabolism
    Rpal_0383
Enzymes [BR:rpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rpal_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
407214..408152
Genome map
AA seq 312 aa AA seqDB search
MVDIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVARVVQRLGGNVEAIFP
AGGFTGKLLKLLLDEENVPNRIVEAVAETREDFSVSENATGEQFRFVLPGLPLAEHEWRG
ILETLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQIGAKFFLDTSGKPLTAALAQG
VTLIKPNLREMQELAGRPLGCEKEWVDAARAHITAGQVEIVALSLGHLGALLVTKDQALR
SPALPVTPVSTVGAGDSFLAAIAHRLAQGGSVADAFRLGLAAGSATLTVHGTQLCGPAEV
ERLYGQVIIEPI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatcgtcacccttacgcccaatcctgcgatcgacctgtcgacgtcggtcgag
cgtttggtgccgagccgcaagctgcgctgcgcggcgcagaagcgcgaccccggcggtggt
ggtatcaacgtggcgcgggtggtgcagcggctcgggggaaacgtcgaggcgatctttccg
gccggcggcttcaccggcaagctgctcaagctgctgctcgacgaggagaacgtcccaaac
cgcatcgtcgaagcggtagcggagacccgcgaggacttctcggtcagcgagaatgccacc
ggcgaacaattccgcttcgtgctgcccggcctgccgctggccgagcacgaatggcgcggc
atcctcgagacgctggcggcgacctcgccggcgccgaagatcgtgatcggcagcggtagc
ctgccgccgggcgtgccggtcgatttttacgcgcaggccgccgcggtggcgaaacagatc
ggcgcgaagttcttcctcgatacctccggcaagccgctgaccgcggcgctggcgcagggc
gtcacgctgatcaagccgaacctgcgcgagatgcaggagctcgccggccgcccgctcggc
tgcgagaaggaatgggtcgacgctgcgcgcgcgcatatcacggccggtcaggtcgagatc
gtggcgctgtccctcggccatctcggcgcgctgctggtcaccaaggaccaggcgctgcgg
tcgccggcgttgccggtgaccccggtgtcgacggtcggtgccggtgacagcttcctggct
gccatcgcgcatcgcctggcgcagggcggttcggtcgccgatgcgttccggctcggtctt
gcggccggctcggcgactctcaccgtgcacggcacgcagctgtgcgggccggccgaggtc
gaacggctgtacgggcaggtgatcatcgagccgatctga

DBGET integrated database retrieval system