KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0387Help
Entry
Rpal_0387         CDS       T00722                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00071  Fatty acid degradation
rpt00280  Valine, leucine and isoleucine degradation
rpt00281  Geraniol degradation
rpt00310  Lysine degradation
rpt00360  Phenylalanine metabolism
rpt00362  Benzoate degradation
rpt00380  Tryptophan metabolism
rpt00410  beta-Alanine metabolism
rpt00627  Aminobenzoate degradation
rpt00640  Propanoate metabolism
rpt00650  Butanoate metabolism
rpt00903  Limonene and pinene degradation
rpt00930  Caprolactam degradation
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpal_0387
   00650 Butanoate metabolism
    Rpal_0387
  Lipid metabolism
   00071 Fatty acid degradation
    Rpal_0387
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpal_0387
   00310 Lysine degradation
    Rpal_0387
   00360 Phenylalanine metabolism
    Rpal_0387
   00380 Tryptophan metabolism
    Rpal_0387
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpal_0387
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpal_0387
   00281 Geraniol degradation
    Rpal_0387
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpal_0387
   00627 Aminobenzoate degradation
    Rpal_0387
   00930 Caprolactam degradation
    Rpal_0387
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpal_0387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACE98947
JGI: Rpal0387
UniProt: B3Q9C3
Position
413707..414507
Genome map
AA seq 266 aa AA seqDB search
MPGQDTVLIERDGPVTIVTINRPERRNAVDGATAKKLYDAFLAFDADESASVAVFTGAGG
TFCAGADLKAVAAGDAEKKREIAGHNTLAPMGPSRLRLSKPVIAAVEGFAVAGGLELALW
ADMRVVAEDATFGVFCRRFGVPLIDLGTIRLPRLIGHSQAMDMILTGRPVTADEAHRIGL
ANRLVPRGEALPRAIELAKQISQFPQTCLRADRLSAFQQWDLPEEDAIMNEMRGGLKVIQ
SGETLSGATRFAQGEGRHGAFGKPAP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccaggataccgtgctgatcgagcgcgacggtccggtgaccatcgtcacgatt
aatcgccccgagcgccgcaacgccgtcgatggcgcgaccgccaaaaaactgtacgacgcc
ttcctggcgttcgatgccgacgagtccgcttccgttgcggtgttcaccggcgcgggcggc
acgttctgcgccggggccgatttgaaagcggtggcggcgggcgatgccgaaaagaagcgc
gaaatcgccggccacaatacgctggcgccgatggggccgagccgtctgcggctgtccaag
ccggtgatcgcggcggtcgagggctttgcggtcgccggcgggctcgaactggcgctgtgg
gccgatatgcgcgtggtcgccgaagacgcgacgttcggggtgttctgccgccgtttcggc
gtgccgctgatcgatctcggcaccatccggttgccgcggctgatcggccattcgcaggcg
atggatatgatcctcaccggccggccggtgacggccgacgaggcgcaccgcatcggcctc
gccaaccgcttggtgccgcgcggtgaagcgctgccgagggcgatcgaactcgccaagcag
atctcgcaattcccgcaaacctgcctgcgcgccgaccggctgtccgccttccagcaatgg
gatctgcccgaggaagacgcgatcatgaacgagatgcgcggcgggctgaaggtcatccag
tccggcgagactctgtccggagcgacccgcttcgcccagggcgaagggcggcatggggcg
ttcggcaagccggctccatga

DBGET integrated database retrieval system