KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0621Help
Entry
Rpal_0621         CDS       T00722                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
675559..676161
Genome map
AA seq 200 aa AA seqDB search
MAGAAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMAPLASALQVAIDKIEVCS
TCGNIDSQNPCTVCTDPRRDSSIIVVVADVADLWALERASATNGRYHVLGATLSPLDGVG
PEDLTIDALVKRAHDPGVAEIILALNATVDGQTTAHYVTDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgccgcaggccccgagatcgaacgtctgattcagttgctggcgcggctaccc
ggattggggccgcgctcggcgcgccgcgccgcgctgcatttgatcaagaagcgcgacgcg
ctgatggcgccgctcgcctccgccctgcaggttgcgatcgacaagatcgaagtgtgcagc
acctgcggcaacatcgattcacaaaacccgtgcacggtgtgcaccgatccgcgacgggat
tcctcgatcatcgtggtggtggccgacgttgcggatttgtgggcactcgaacgcgcctct
gccacaaacggccggtaccacgttctgggagcgacgctctcgccgctcgacggcgtcggc
cccgaagatctgacgatcgacgcgttggtgaagcgtgcacatgaccccggcgttgccgag
atcatcctggcgctcaacgcaaccgtcgatggccagaccaccgcacattacgtcaccgac
ctcttgcaggacgccaacgtcaaggtgacccggctcgctcacggcgtgccggtcggtggc
gaactcgactatctcgacgaaggtacgctgtcggcggcgatgcgacagcgcaccttgttc
tga

DBGET integrated database retrieval system