KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0814Help
Entry
Rpal_0814         CDS       T00722                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
Enzymes [BR:rpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Rpal_0814
Lipid biosynthesis proteins [BR:rpt01004]
 Acyl-CoA synthetase
  Unknown
   Rpal_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
855316..856842
Genome map
AA seq 508 aa AA seqDB search
MSFAYFDWIAHHAEVRPERIAVVDLATSRKISYRAMDERVDRLAAHLAALGVGRGDRVAV
LALNAVETLEVQFACFRLGAIFVPLNVRLTVHELSYIVGDAAPRVLAHDDELAPMATELK
AACSVPHLLAFGPAYEAALAASPLLGASEPVTLDDVSTIMYTSGTTGKPKGAMITHGMTF
INAVNLGIPAFISQRTVFLCVLPLFHTGGLNCYTNPVLHAGGTTLLMRAFDPGAALSIIG
DPSVGLTHFFGVPSIYQFMCQHAAFAATDLLRLQIAGVGGAPMPVPLLKIWQERGCALVQ
GYGMTETSPAVLMLDADDAARKAGSAGKPVLHADLKIVGPDGAPVKPGEMGELWVKGPNI
TPGYWNRPDANRTSFTDGWLHTGDAARVDDEGFYYIVDRTKDMYISGGENVYPAEVEDVL
YQLPEIAEAAVIGAPDPQWGETGVAVVALKPGQELSEAKLLAHCRERLARFKCPQRVSFV
EALPRNATGKVHKPTLRERILVRETADA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgcttacttcgactggatcgcccatcacgccgaggtccgccccgagcggatc
gcggtggtcgatctcgccaccagtcgcaagatcagctaccgcgcaatggacgaacgggtc
gaccggttggctgcccatctcgctgcgcttggcgttggccgtggcgaccgggtcgcggtg
ctggcgctgaatgcggtcgagacgctggaggtgcagttcgcctgcttccggctcggcgcg
atcttcgtgccgcttaatgtccggctcaccgtgcacgaactatcctacatcgtcggcgac
gccgcgccgcgggtgctggcgcatgacgacgagctggctccgatggcgacggagttgaag
gcggcctgcagcgtgccgcatctgttggcgttcggcccggcctacgaggcggcgctggcg
gcctcgccgctgctcggagcctccgagcctgtgacgctcgatgacgtctccaccatcatg
tacacctccggcaccaccggaaagccgaagggcgccatgatcacccatggaatgaccttc
atcaacgcggtcaatctcggcattccggcgttcatttcgcaacgcacggtgtttctctgc
gtgctgccgctgttccacaccggcgggctcaattgctacaccaatccggtgctgcacgcc
ggcggcaccacattgttgatgcgcgcgttcgatccgggcgcagcgctgtcgattatcggt
gatccgtcggtcgggctgacgcatttcttcggggtcccctcgatctatcagttcatgtgc
cagcatgcggcgttcgcggcgaccgatctgttgcggctgcagatcgccggggtcggcggc
gctccgatgccggtacccctcttgaagatctggcaggagcgtggctgcgccttggtccaa
ggctacggcatgaccgagaccagcccggcggtgctgatgctcgatgccgacgatgccgcg
cgcaaggccggctcggccggcaaaccggtgctgcacgccgatctcaagatcgtcggccca
gacggcgcgccggtgaaaccgggcgagatgggcgaactctgggtgaagggcccgaacatc
acccccggctattggaacaggccggacgccaatcgcacctcgttcaccgacggctggctg
cacaccggcgacgcggcgcgggtcgacgacgaaggcttctattacatcgtcgaccgcacc
aaggacatgtacatctcgggcggcgagaacgtatacccggccgaggtcgaggacgtgctg
taccaattgccggagattgccgaagcggcagtgatcggcgcgcctgatccgcaatggggc
gaaaccggcgtcgcggtggtcgcgctcaaacccggccaggaactgagcgaggcgaagctg
ctggcgcactgccgcgagcggctggcgcggttcaaatgtccgcagcgcgtcagcttcgtc
gaagcgctgccgcgcaacgccaccggcaaggtgcacaagccgacgctgcgcgaacgcatt
ctggtgcgggagaccgccgacgcgtga

DBGET integrated database retrieval system